Homologs in group_877

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04490 FBDBKF_04490 100.0 Morganella morganii S1 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
EHELCC_05780 EHELCC_05780 100.0 Morganella morganii S2 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
NLDBIP_06100 NLDBIP_06100 100.0 Morganella morganii S4 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
LHKJJB_02980 LHKJJB_02980 100.0 Morganella morganii S3 fabG NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
F4V73_RS08945 F4V73_RS08945 95.0 Morganella psychrotolerans - acetoin reductase
PMI_RS10305 PMI_RS10305 85.3 Proteus mirabilis HI4320 - acetoin reductase

Distribution of the homologs in the orthogroup group_877

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_877

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q48436 4.2e-92 275 54 0 254 1 budC Diacetyl reductase [(S)-acetoin forming] Klebsiella pneumoniae
Q9ZNN8 1.06e-84 256 54 1 256 1 budC L-2,3-butanediol dehydrogenase Corynebacterium glutamicum
Q5HKG6 5.69e-84 254 50 1 255 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CQD2 8.06e-84 254 50 1 255 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P66776 5.75e-72 224 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MW2)
Q6GCZ8 5.75e-72 224 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MSSA476)
Q6GKH9 5.75e-72 224 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain MRSA252)
P99120 5.75e-72 224 47 0 254 1 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain N315)
P66775 5.75e-72 224 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJP2 5.75e-72 224 47 0 254 3 butA Diacetyl reductase [(S)-acetoin forming] Staphylococcus aureus (strain COL)
Q04520 1.63e-67 212 54 0 194 3 budC Diacetyl reductase [(S)-acetoin forming] Raoultella terrigena
A0A2H3D8Y2 1.06e-66 210 46 2 256 1 ARMGADRAFT_1018421 Short-chain dehydrogenase/reductase ARMGADRAFT_1018421 Armillaria gallica
A9CES4 3.74e-49 165 39 1 255 1 Atu3164 Galactitol 2-dehydrogenase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q59787 1.8e-48 164 37 1 255 1 polS Sorbitol dehydrogenase Cereibacter sphaeroides
Q9X248 1.47e-45 155 36 2 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
C8WGQ3 2.94e-45 155 37 7 264 1 Elen_1325 3beta-hydroxysteroid dehydrogenase 2 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
A0A1V0QSC6 1.48e-43 150 38 3 257 1 eriH Short-chain dehydrogenase/reductase eriH Hericium erinaceus
P94681 3.21e-43 150 37 4 256 1 tsaC1 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 Comamonas testosteroni
P9WGT1 1.89e-41 145 40 5 258 1 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P69166 1.89e-41 145 40 5 258 3 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q49117 6.72e-41 144 39 3 255 3 MexAM1_META1p0182 Uncharacterized oxidoreductase MexAM1_META1p0182 Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
P51831 7.98e-41 144 36 3 257 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Bacillus subtilis (strain 168)
P9WGT0 1.17e-40 144 40 5 258 3 fabG3 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P37769 2.24e-40 142 34 3 262 1 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Escherichia coli (strain K12)
E9ET40 2.09e-39 140 36 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
P0A0I0 2.38e-39 140 38 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MW2)
Q6G9Y2 2.38e-39 140 38 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MSSA476)
Q6GHK4 2.38e-39 140 38 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain MRSA252)
P99093 2.38e-39 140 38 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain N315)
P0A0H9 2.38e-39 140 38 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGK2 2.38e-39 140 38 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus aureus (strain COL)
A0A0B4GT47 2.51e-39 140 36 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium anisopliae (strain ARSEF 549)
P0A2D1 2.66e-39 140 37 6 256 3 ucpA Oxidoreductase UcpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D2 2.66e-39 140 37 6 256 3 ucpA Oxidoreductase UcpA Salmonella typhi
Q93X62 5.48e-39 141 38 5 253 1 gbkr1 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic Brassica napus
Q93X67 5.59e-39 141 38 5 253 2 bkr2 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic Brassica napus
Q8XBJ4 5.74e-39 139 36 6 256 3 ucpA Oxidoreductase UcpA Escherichia coli O157:H7
Q949M3 6.31e-39 140 38 5 253 2 bkr3 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic Brassica napus
A0A0B4HVU2 1.18e-38 139 35 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium majus (strain ARSEF 297)
P37440 1.2e-38 138 36 6 256 1 ucpA Oxidoreductase UcpA Escherichia coli (strain K12)
A0A0B4FP77 2.05e-38 138 35 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium brunneum (strain ARSEF 3297)
Q5FPE5 2.53e-38 137 37 6 261 1 GOX2015 Glucose 1-dehydrogenase Gluconobacter oxydans (strain 621H)
Q937L4 4.13e-38 137 35 3 250 1 cpnA Cyclopentanol dehydrogenase Comamonas testosteroni
Q8GAV9 4.13e-38 137 35 3 250 1 cpnA Cyclopentanol dehydrogenase Comamonas sp. (strain NCIMB 9872)
A0A0B4GU97 4.93e-38 137 35 4 260 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium guizhouense (strain ARSEF 977)
Q00791 9.64e-38 136 35 5 260 2 stcU Versicolorin reductase stcU Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8CPI3 4.85e-37 134 36 3 253 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPW0 4.85e-37 134 36 3 253 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P80873 1.28e-36 134 35 5 255 1 ydaD General stress protein 39 Bacillus subtilis (strain 168)
P40398 1.85e-36 134 35 5 260 3 yhxD Uncharacterized oxidoreductase YhxD Bacillus subtilis (strain 168)
Q92506 2.08e-36 132 33 3 262 1 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Homo sapiens
E9EHG1 2.71e-36 132 34 5 262 3 Arp2 Hydroxynaphthalene reductase-like protein Arp2 Metarhizium acridum (strain CQMa 102)
H9XP47 3.52e-36 132 35 5 255 1 budC Meso-2,3-butanediol dehydrogenase Serratia marcescens
A7AZH2 4.63e-36 132 34 6 267 1 RUMGNA_00694 3beta-hydroxysteroid dehydrogenase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
P66782 9.76e-36 130 33 3 253 3 fabG2 Uncharacterized oxidoreductase Mb1385 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGR9 9.76e-36 130 33 3 253 1 fabG2 Uncharacterized oxidoreductase Rv1350 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGR8 9.76e-36 130 33 3 253 3 fabG2 Uncharacterized oxidoreductase MT1393 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P33207 1.21e-35 132 37 5 253 1 At1g24360 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic Arabidopsis thaliana
Q05528 1.63e-35 130 33 2 257 1 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Dickeya dadantii (strain 3937)
A7B3K3 1.91e-35 130 33 3 256 1 baiA 3alpha-hydroxysteroid dehydrogenase Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)
A0A411PQN6 2.67e-35 130 33 5 257 3 AgnL6 Short chain dehydrogenase AgnL6 Paecilomyces divaricatus
P28643 3.34e-35 131 36 4 252 2 CLKR27 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic Cuphea lanceolata
Q9WYG0 4.55e-35 129 33 4 256 3 TM_0325 Uncharacterized oxidoreductase TM_0325 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P9WGQ9 5.06e-35 129 36 5 257 1 Rv0769 Uncharacterized oxidoreductase Rv0769 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGQ8 5.06e-35 129 36 5 257 3 MT0793 Uncharacterized oxidoreductase MT0793 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q949M2 5.74e-35 129 37 6 253 2 bkr4 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) Brassica napus
Q9KJF1 8.16e-35 128 33 5 257 1 bbsD (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD Thauera aromatica
P50161 8.37e-35 128 33 6 261 1 aflM Versicolorin reductase 1 Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
Q08632 1.23e-34 128 34 6 266 2 None Short-chain type dehydrogenase/reductase Picea abies
P87025 1.34e-34 128 32 5 260 3 THR1 Trihydroxynaphthalene reductase Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)
P50842 1.63e-34 127 36 7 263 2 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Bacillus subtilis (strain 168)
Q6TMA3 1.63e-34 128 35 10 280 1 chnA Cyclohexanol dehydrogenase Rhodococcus sp. (strain TK6)
O67610 2.55e-34 127 32 3 257 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Aquifex aeolicus (strain VF5)
P80869 2.61e-34 127 31 3 257 1 ycdF Glucose 1-dehydrogenase 2 Bacillus subtilis (strain 168)
Q9PKF7 3.09e-34 126 32 3 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia muridarum (strain MoPn / Nigg)
Q5TJF5 3.56e-34 127 33 3 264 3 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Canis lupus familiaris
P39483 3.81e-34 127 30 4 256 3 gdhII Glucose 1-dehydrogenase 2 Priestia megaterium
Q8JZV9 4.53e-34 126 36 8 254 1 Bdh2 Dehydrogenase/reductase SDR family member 6 Mus musculus
W3XC32 5.67e-34 127 32 5 257 2 Pfmaj Trihydroxynaphthalene reductase PfmaI Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q8KWT4 7.35e-34 125 33 5 256 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus subtilis
A0A1L9WLH9 7.74e-34 126 31 6 263 1 AacuN Short chain dehydrogenase/reductase AacuN Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q10216 8.52e-34 126 34 7 258 3 SPAC4H3.08 Uncharacterized oxidoreductase C4H3.08 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
F9XMW6 9.44e-34 125 33 6 260 3 MYCGRDRAFT_87994 Probable tetrahydroxynaphthalene reductase MYCGRDRAFT_87994 Zymoseptoria tritici (strain CBS 115943 / IPO323)
P38004 1.11e-33 125 32 3 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P42317 1.19e-33 125 33 2 251 3 yxjF Uncharacterized oxidoreductase YxjF Bacillus subtilis (strain 168)
P39640 1.22e-33 125 33 4 256 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus subtilis (strain 168)
P17611 1.24e-33 125 35 3 258 3 nodG Nodulation protein G Azospirillum brasilense
Q9RA05 1.27e-33 125 35 6 273 1 limC (-)-trans-carveol dehydrogenase Rhodococcus erythropolis
Q988B7 1.69e-33 124 34 5 257 1 pldh-t Pyridoxal 4-dehydrogenase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A0A384JQF5 1.96e-33 125 35 6 258 2 aba4 Short-chain dehydrogenase/reductase aba4 Botryotinia fuckeliana (strain B05.10)
Q9Z8P2 1.99e-33 124 32 3 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Chlamydia pneumoniae
Q93X68 2.01e-33 126 36 5 252 2 bkr1 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) Brassica napus
A0A1L5BUG8 2.72e-33 124 35 4 254 3 linB 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)
P0DXE0 2.76e-33 124 35 6 256 1 chcB1 Trans-4-hydroxycyclohexanecarboxylate dehydrogenase Corynebacterium cyclohexanicum
Q14RS1 4.03e-33 124 35 6 258 2 aba4 Short-chain dehydrogenase/reductase aba4 Botryotinia fuckeliana
O54438 4.03e-33 124 32 2 256 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39484 4.42e-33 124 31 4 256 3 gdhIII Glucose 1-dehydrogenase 3 Priestia megaterium
Q9F7E0 4.84e-33 124 34 4 253 1 chnA Cyclohexanol dehydrogenase Acinetobacter sp. (strain SE19)
P12310 4.92e-33 124 31 4 255 2 gdh Glucose 1-dehydrogenase Bacillus subtilis (strain 168)
I6YCF0 5.04e-33 124 34 3 250 1 ipdF (5R,7aS)-5-hydroxy-7a-methyl-1-oxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P39485 5.95e-33 124 31 4 256 1 gdhIV Glucose 1-dehydrogenase 4 Priestia megaterium
M1W270 6.66e-33 123 31 5 261 2 CPUR_05429 Short chain dehydrogenase CPUR_05429 Claviceps purpurea (strain 20.1)
D4A1J4 7.5e-33 123 36 8 254 1 Bdh2 Dehydrogenase/reductase SDR family member 6 Rattus norvegicus
P10528 7.84e-33 123 31 4 256 3 gdhA Glucose 1-dehydrogenase A Priestia megaterium
Q45219 8.39e-33 124 33 4 257 3 blr2146 Probable short-chain type dehydrogenase/reductase blr2146 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q15SS0 9.83e-33 123 36 8 263 1 Patl_2552 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q21929 9.86e-33 122 34 3 257 1 dhs-21 L-xylulose reductase Caenorhabditis elegans
P16544 1.09e-32 123 34 2 255 1 actIII Putative ketoacyl reductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
D4YYG1 1.35e-32 122 35 4 255 1 linC 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)
Q9LBG2 1.52e-32 122 32 4 256 1 lvr Levodione reductase Leifsonia aquatica
A0A5B8YU81 1.59e-32 122 32 7 263 2 GME11373 Short-chain dehydrogenase/reductase GME11373 Pestalotiopsis microspora
M2WJF1 2.42e-32 122 32 6 262 2 ver1 Versicolorin reductase 1 Dothistroma septosporum (strain NZE10 / CBS 128990)
Q8TFD5 2.42e-32 122 32 6 262 2 ver1 Versicolorin reductase 1 Dothistroma septosporum
Q5KTS5 2.88e-32 122 34 6 264 2 CAISE5 Glucose and ribitol dehydrogenase Daucus carota
Q561X9 2.92e-32 121 35 9 256 2 bdh2 Dehydrogenase/reductase SDR family member 6 Danio rerio
Q3T046 3.11e-32 121 35 7 255 2 BDH2 Dehydrogenase/reductase SDR family member 6 Bos taurus
A7IQH5 3.63e-32 121 35 6 241 1 xecE3 2-(S)-hydroxypropyl-CoM dehydrogenase 3 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P55541 3.75e-32 122 32 4 258 3 NGR_a02730 Uncharacterized short-chain type dehydrogenase/reductase y4lA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P23238 3.88e-32 121 33 3 250 3 phaB Acetoacetyl-CoA reductase Shinella zoogloeoides
Q6MGB5 4.12e-32 121 35 4 267 1 Hsd17b8 (3R)-3-hydroxyacyl-CoA dehydrogenase Rattus norvegicus
Q3KPT7 4.42e-32 121 35 9 256 2 bdh2 Dehydrogenase/reductase SDR family member 6 Xenopus laevis
O31680 4.6e-32 121 32 4 252 3 ykvO Uncharacterized oxidoreductase YkvO Bacillus subtilis (strain 168)
Q9URX0 4.72e-32 121 33 7 259 3 SPAC922.06 Uncharacterized oxidoreductase C922.06 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P33368 5.07e-32 121 32 2 253 1 yohF Uncharacterized oxidoreductase YohF Escherichia coli (strain K12)
Q75KH3 6.03e-32 122 32 6 270 2 Os05g0140800 Glucose and ribitol dehydrogenase homolog Oryza sativa subsp. japonica
P50164 6.51e-32 120 32 4 256 2 TR2 Tropinone reductase 2 Hyoscyamus niger
Q12634 7.02e-32 121 32 7 267 1 MGG_02252 Tetrahydroxynaphthalene reductase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P0C622 7.45e-32 120 31 3 256 3 cmtB 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase Pseudomonas putida
A5W4G5 7.45e-32 120 31 3 256 3 cmtB 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P50163 7.63e-32 120 32 4 256 1 TR2 Tropinone reductase 2 Datura stramonium
O07575 8.26e-32 121 32 6 255 3 yhdF Uncharacterized oxidoreductase YhdF Bacillus subtilis (strain 168)
Q9KQH7 1.03e-31 120 32 3 256 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P06234 1.07e-31 120 33 3 254 3 nodG Nodulation protein G Rhizobium meliloti (strain 1021)
A0A4P8DJW8 1.25e-31 120 31 6 262 3 dmxR18 Short chain dehydrogenase/reductase dmxR18 Cryptosporiopsis sp. (strain 8999)
P39482 1.35e-31 120 29 3 255 2 gdhI Glucose 1-dehydrogenase 1 Priestia megaterium
Q9X6U2 1.4e-31 120 34 2 256 3 hbdH1 D-beta-hydroxybutyrate dehydrogenase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P46331 1.47e-31 120 33 5 257 3 yxbG Uncharacterized oxidoreductase YxbG Bacillus subtilis (strain 168)
P40288 2.07e-31 119 29 3 255 1 None Glucose 1-dehydrogenase Priestia megaterium
P41177 2.64e-31 119 34 1 254 3 None Monensin polyketide synthase putative ketoacyl reductase Streptomyces virginiae
Q9SQR4 3.67e-31 119 32 6 270 3 At3g03980 NADPH-dependent aldehyde reductase-like protein, chloroplastic Arabidopsis thaliana
P72332 4.6e-31 118 33 3 254 3 nodG Nodulation protein G Rhizobium sp. (strain N33)
P50941 4.7e-31 118 32 4 255 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia prowazekii (strain Madrid E)
D4Z260 4.71e-31 118 34 2 253 1 linX 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)
A0A1L5BU05 4.71e-31 118 34 2 253 3 linX 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)
P50205 5.06e-31 118 33 3 250 3 phaB Acetoacetyl-CoA reductase Rhizobium meliloti (strain 1021)
Q5P5I4 5.39e-31 118 33 4 256 1 ped (S)-1-Phenylethanol dehydrogenase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q5BH34 5.68e-31 118 30 3 255 1 mdpC Short chain dehydrogenase mdpC Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P40397 5.9e-31 119 32 8 263 3 yhxC Uncharacterized oxidoreductase YhxC Bacillus subtilis (strain 168)
P0CU75 6.88e-31 118 31 8 263 1 claC Short chain dehydrogenase claC Passalora fulva
Q6WVP7 1.5e-30 117 32 5 259 1 adh NADP-dependent (R)-specific alcohol dehydrogenase Lentilactobacillus kefiri
C1C4R8 1.54e-30 117 35 9 256 2 bdh2 Dehydrogenase/reductase SDR family member 6 Aquarana catesbeiana
P50199 1.59e-30 117 30 3 259 1 gno Gluconate 5-dehydrogenase Gluconobacter oxydans (strain 621H)
P55336 4.11e-30 115 31 4 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Vibrio harveyi
Q8WNV7 4.21e-30 116 30 5 259 1 DHRS4 Dehydrogenase/reductase SDR family member 4 Sus scrofa
A0A2I1C3T5 4.34e-30 116 30 6 262 1 nsrJ Short chain dehydrogenase/reductase nsrJ Aspergillus novofumigatus (strain IBT 16806)
Q9SQR2 4.62e-30 116 33 8 271 1 ChlADR2 NADPH-dependent aldehyde reductase 2, chloroplastic Arabidopsis thaliana
A7DY56 8.07e-30 115 31 4 257 1 TR Tropinone reductase Cochlearia officinalis
C8WJW0 8.5e-30 115 34 4 255 1 Elen_0198 3beta-hydroxysteroid dehydrogenase 1 Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)
Q9LHT0 8.71e-30 115 33 4 256 2 At5g06060 Tropinone reductase homolog At5g06060 Arabidopsis thaliana
E9QUT3 1.02e-29 115 31 4 253 3 arp2 Hydroxynaphthalene reductase arp2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9L9F8 1.82e-29 114 34 3 250 1 novJ Short-chain reductase protein NovJ Streptomyces niveus
Q8KWS9 2.08e-29 114 32 7 259 1 bacC Dihydroanticapsin 7-dehydrogenase Bacillus amyloliquefaciens
A0R518 2.22e-29 114 32 4 274 1 MSMEG_6031 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P0DXE1 5.4e-29 113 34 5 255 1 chcB2 Cis-4-hydroxycyclohexanecarboxylate dehydrogenase Corynebacterium cyclohexanicum
O86034 5.58e-29 113 33 6 262 1 bdhA D-beta-hydroxybutyrate dehydrogenase Rhizobium meliloti (strain 1021)
P43713 6.12e-29 112 31 5 259 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37694 6.59e-29 114 33 6 252 3 hetN Ketoacyl reductase HetN Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P73574 6.86e-29 112 34 5 259 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8NUV9 7.44e-29 112 34 2 188 3 MW2403 Uncharacterized oxidoreductase MW2403 Staphylococcus aureus (strain MW2)
Q6G6J1 7.44e-29 112 34 2 188 3 SAS2370 Uncharacterized oxidoreductase SAS2370 Staphylococcus aureus (strain MSSA476)
Q99LB2 1.36e-28 112 30 5 259 1 Dhrs4 Dehydrogenase/reductase SDR family member 4 Mus musculus
B0ZT44 1.5e-28 112 33 6 260 2 RDT1 Elsinochrome reductase 1 Elsinoe fawcettii
P14802 1.69e-28 111 38 1 176 3 yoxD Uncharacterized oxidoreductase YoxD Bacillus subtilis (strain 168)
P07999 1.88e-28 112 29 6 259 1 gdhB Glucose 1-dehydrogenase B Priestia megaterium
Q89AG9 2.16e-28 111 26 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
H9BFQ2 2.62e-28 111 32 6 257 2 None Tropinone reductase-like 3 Erythroxylum coca
Q9ZW04 2.81e-28 111 31 5 256 3 At2g29170 Tropinone reductase homolog At2g29170 Arabidopsis thaliana
Q2FVD5 3.07e-28 110 35 2 188 3 SAOUHSC_02778 Uncharacterized oxidoreductase SAOUHSC_02778 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q5HD73 3.07e-28 110 35 2 188 3 SACOL2488 Uncharacterized oxidoreductase SACOL2488 Staphylococcus aureus (strain COL)
Q2FE21 3.07e-28 110 35 2 188 3 SAUSA300_2422 Uncharacterized oxidoreductase SAUSA300_2422 Staphylococcus aureus (strain USA300)
P70720 4.4e-28 110 32 4 253 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Aggregatibacter actinomycetemcomitans
P16542 4.7e-28 111 35 2 233 3 gra-orf5 Granaticin polyketide synthase putative ketoacyl reductase 1 Streptomyces violaceoruber
Q68VY7 5.25e-28 110 31 4 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P0AG84 5.3e-28 111 32 4 256 1 yghA Uncharacterized oxidoreductase YghA Escherichia coli (strain K12)
P0AG85 5.3e-28 111 32 4 256 3 yghA Uncharacterized oxidoreductase YghA Escherichia coli O157:H7
P50171 5.36e-28 110 35 4 267 1 Hsd17b8 (3R)-3-hydroxyacyl-CoA dehydrogenase Mus musculus
P19871 5.75e-28 110 33 5 260 1 None 3-beta-hydroxysteroid dehydrogenase Comamonas testosteroni
P95727 7.59e-28 110 32 4 252 1 chcA 1-cyclohexenylcarbonyl-CoA reductase Streptomyces collinus
Q9ZW03 7.69e-28 110 32 7 258 1 At2g29150 Tropinone reductase homolog At2g29150 Arabidopsis thaliana
F1SWA0 7.94e-28 110 32 3 257 1 ZSD1 Zerumbone synthase Zingiber zerumbet
Q8P3K4 1.04e-27 110 33 6 259 1 XCC4067 2-keto-3-deoxy-L-fuconate dehydrogenase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q5C9I9 1.15e-27 110 34 6 258 1 None (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial Mentha piperita
Q9SCU0 1.16e-27 110 30 4 263 3 SDR2a Short-chain dehydrogenase reductase 2a Arabidopsis thaliana
P0AEK3 1.25e-27 109 31 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Shigella flexneri
P0AEK2 1.25e-27 109 31 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Escherichia coli (strain K12)
Q92EU6 1.33e-27 109 30 6 257 1 golD NAD-dependent glycerol dehydrogenase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5HLD8 1.76e-27 108 35 4 191 3 SERP2049 Uncharacterized oxidoreductase SERP2049 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN40 1.76e-27 108 35 4 191 3 SE_2036 Uncharacterized oxidoreductase SE_2036 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9FZ42 1.89e-27 110 31 6 264 1 ChlADR1 NADPH-dependent aldehyde reductase 1, chloroplastic Arabidopsis thaliana
Q9MA93 2.16e-27 109 32 7 264 2 At3g05260 Glucose and ribitol dehydrogenase homolog 2 Arabidopsis thaliana
Q9ZW18 2.79e-27 108 31 4 256 1 SAG13 Senescence-associated protein 13 Arabidopsis thaliana
P0A2C9 2.87e-27 108 30 5 258 1 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D0 2.87e-27 108 30 5 258 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Salmonella typhi
O34717 4.46e-27 108 29 3 255 2 fadH Probable 2,4-dienoyl-CoA reductase [(2E)-enoyl-CoA-producing] Bacillus subtilis (strain 168)
P50162 4.46e-27 108 32 6 259 1 TR1 Tropinone reductase 1 Datura stramonium
Q99RF5 6.6e-27 107 34 2 188 3 SAV2478 Uncharacterized oxidoreductase SAV2478 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A3L9 6.6e-27 107 34 2 188 1 SA2266 Uncharacterized oxidoreductase SA2266 Staphylococcus aureus (strain N315)
Q6GDV6 7.9e-27 107 33 2 188 3 SAR2567 Uncharacterized oxidoreductase SAR2567 Staphylococcus aureus (strain MRSA252)
C0KTJ6 8.28e-27 107 34 8 260 1 None Galactitol 2-dehydrogenase (L-tagatose-forming) Cereibacter sphaeroides
Q53217 8.54e-27 111 34 6 252 3 NGR_a01150 Uncharacterized short-chain type dehydrogenase/reductase y4vI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q53217 1.95e-13 73 26 5 252 3 NGR_a01150 Uncharacterized short-chain type dehydrogenase/reductase y4vI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0DKI3 9.5e-27 107 32 4 258 1 At1g07440 Tropinone reductase homolog At1g07440 Arabidopsis thaliana
Q9GKX2 1.09e-26 107 29 4 258 1 DHRS4 Dehydrogenase/reductase SDR family member 4 (Fragment) Oryctolagus cuniculus
W3XAA0 1.12e-26 107 34 5 259 1 PfmaG Tetrahydroxynaphthalene reductase PfmaG Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
A0A1A9TAK5 1.21e-26 107 30 5 258 1 NR Noroxomaritidine/norcraugsodine reductase Narcissus pseudonarcissus
A0A1C9II22 1.21e-26 107 30 5 258 1 NR Noroxomaritidine/norcraugsodine reductase Narcissus aff. pseudonarcissus MK-2014
Q8SPU8 1.37e-26 107 30 5 256 2 DHRS4 Dehydrogenase/reductase SDR family member 4 Bos taurus
O80714 1.43e-26 107 32 9 265 3 SDR3c Short-chain dehydrogenase reductase 3c Arabidopsis thaliana
P07772 1.45e-26 107 34 6 255 3 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9BUT1 1.51e-26 106 34 8 254 1 BDH2 Dehydrogenase/reductase SDR family member 6 Homo sapiens
Q9ZW14 1.84e-26 106 32 5 256 2 At2g29310 Tropinone reductase homolog At2g29310 Arabidopsis thaliana
Q8VID1 1.92e-26 107 29 5 260 2 Dhrs4 Dehydrogenase/reductase SDR family member 4 Rattus norvegicus
G4N1P8 2.33e-26 106 31 6 261 2 ABA4 Short-chain dehydrogenase/reductase ABA4 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
L7I518 2.33e-26 106 31 6 261 2 ABA4 Short-chain dehydrogenase/reductase ABA4 Pyricularia oryzae (strain Y34)
Q6P0H7 2.46e-26 105 31 4 251 2 cbr4 Carbonyl reductase family member 4 Danio rerio
P19337 2.46e-26 106 33 9 262 1 baiA2 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 2 Clostridium scindens (strain JCM 10418 / VPI 12708)
Q8JIS3 2.48e-26 105 29 5 264 1 DER D-erythrulose reductase Gallus gallus
Q56841 2.49e-26 106 34 7 257 1 xecE1 2-(S)-hydroxypropyl-CoM dehydrogenase 1 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A0A3Q8GL18 2.67e-26 106 30 8 261 1 NEPS1 (+)-cis,trans-nepetalactol synthase NEPS1 Nepeta racemosa
P39071 2.71e-26 106 32 4 255 1 dhbA 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Bacillus subtilis (strain 168)
Q4A054 2.86e-26 105 34 3 192 3 SSP0419 Uncharacterized oxidoreductase SSP0419 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A0A1U8QWA2 3.6e-26 110 35 2 210 1 ATRR Glycine betaine reductase ATRR Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9C826 3.7e-26 106 32 7 262 1 ABA2 Xanthoxin dehydrogenase Arabidopsis thaliana
P0DOV5 4.25e-26 105 31 6 264 1 PpSQ1_00405 Sulfoquinovose 1-dehydrogenase Pseudomonas putida
Q91VT4 4.37e-26 105 33 6 251 1 Cbr4 3-oxoacyl-[acyl-carrier-protein] reductase Mus musculus
A0A8F5XX49 4.43e-26 106 33 8 266 1 BDH2 (+)-borneol dehydrogenase 2 Salvia officinalis
O31642 4.76e-26 105 31 9 260 3 yjdA Uncharacterized oxidoreductase YjdA Bacillus subtilis (strain 168)
Q8N4T8 5.23e-26 105 33 5 251 1 CBR4 3-oxoacyl-[acyl-carrier-protein] reductase Homo sapiens
P45375 5.5e-26 105 32 3 253 3 phaB Acetoacetyl-CoA reductase Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
A3LZU7 5.88e-26 105 35 5 259 1 DHG2 L-rhamnose-1-dehydrogenase Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q9HK58 6.06e-26 105 29 4 255 1 rhaD L-rhamnose 1-dehydrogenase (NADP(+)) Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q6NUE2 6.38e-26 104 30 6 251 2 cbr4 Carbonyl reductase family member 4 Xenopus laevis
P76633 8.04e-26 105 29 4 260 3 ygcW Uncharacterized oxidoreductase YgcW Escherichia coli (strain K12)
Q7TS56 9.12e-26 104 32 5 251 2 Cbr4 3-oxoacyl-[acyl-carrier-protein] reductase Rattus norvegicus
P55575 1.01e-25 104 31 6 265 3 NGR_a02430 Uncharacterized short-chain type dehydrogenase/reductase y4mP Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92RN6 1.22e-25 104 31 4 259 3 galD Probable galactose dehydrogenase GalD Rhizobium meliloti (strain 1021)
P50204 1.24e-25 103 31 3 242 3 phaB Acetoacetyl-CoA reductase Paracoccus denitrificans
G9FRD7 1.26e-25 104 31 4 257 1 hdha 7alpha-hydroxysteroid dehydrogenase Clostridium sardiniense
P19992 1.27e-25 104 34 7 255 1 None 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase Streptomyces exfoliatus
Q8VCR2 1.32e-25 105 31 3 193 1 Hsd17b13 17-beta-hydroxysteroid dehydrogenase 13 Mus musculus
Q56840 1.39e-25 104 31 6 255 1 xecD1 2-(R)-hydroxypropyl-CoM dehydrogenase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q9ZW13 1.43e-25 104 30 4 256 2 At2g29290 Tropinone reductase homolog At2g29290 Arabidopsis thaliana
A4IFA7 1.45e-25 103 32 5 251 2 CBR4 3-oxoacyl-[acyl-carrier-protein] reductase Bos taurus
P07914 1.46e-25 103 32 9 262 1 baiA1 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 1/3 Clostridium scindens (strain JCM 10418 / VPI 12708)
F4IKM1 1.56e-25 105 32 4 257 2 At2g29340 Tropinone reductase homolog At2g29340 Arabidopsis thaliana
Q8K9J5 2.15e-25 103 26 3 256 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9ZW20 2.2e-25 103 30 5 257 3 At2g29370 Tropinone reductase homolog At2g29370 Arabidopsis thaliana
G5EGA6 2.21e-25 103 32 5 259 1 dhrs-4 Dehydrogenase/reductase SDR family member 4 Caenorhabditis elegans
P15047 2.97e-25 103 32 6 262 1 entA 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Escherichia coli (strain K12)
Q2UEK6 3.06e-25 103 31 5 262 2 astEA Short chain dehydrogenase/reductase astE Aspergillus oryzae (strain ATCC 42149 / RIB 40)
O49332 3.09e-25 103 31 5 258 3 At2g30670 Tropinone reductase homolog At2g30670 Arabidopsis thaliana
Q5M875 3.57e-25 104 31 3 193 1 Hsd17b13 17-beta-hydroxysteroid dehydrogenase 13 Rattus norvegicus
Q7Z5P4 3.84e-25 103 27 2 192 1 HSD17B13 17-beta-hydroxysteroid dehydrogenase 13 Homo sapiens
Q4UK62 4.19e-25 102 33 4 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q94KL7 4.89e-25 103 30 6 257 1 None Secoisolariciresinol dehydrogenase (Fragment) Forsythia intermedia
W6QDA7 4.95e-25 103 29 6 269 1 anuF Short-chain dehydrogenase anuF Penicillium roqueforti (strain FM164)
Q13268 5.02e-25 103 29 4 253 1 DHRS2 Dehydrogenase/reductase SDR family member 2, mitochondrial Homo sapiens
P70684 5.24e-25 103 34 5 217 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Cavia porcellus
Q73SC8 5.28e-25 103 32 3 267 1 MAP_4146 Uncharacterized NAD-dependent oxidoreductase MAP_4146 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q1JP75 5.8e-25 102 32 5 264 2 DCXR L-xylulose reductase Bos taurus
P05707 6.16e-25 102 30 3 255 1 srlD Sorbitol-6-phosphate 2-dehydrogenase Escherichia coli (strain K12)
P50160 6.28e-25 104 32 8 282 2 TS2 Sex determination protein tasselseed-2 Zea mays
P9WGS3 6.45e-25 106 32 0 186 1 ephD Probable oxidoreductase EphD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS2 6.45e-25 106 32 0 186 3 ephD Probable oxidoreductase EphD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66778 6.45e-25 106 32 0 186 3 ephD Probable oxidoreductase EphD Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9BTZ2 6.47e-25 103 29 4 258 1 DHRS4 Dehydrogenase/reductase SDR family member 4 Homo sapiens
A0A2U8U2K8 7.62e-25 102 30 7 257 1 asL5 Oxidoreductase asL5 Sarocladium schorii
Q9ZW19 7.97e-25 102 29 4 257 1 SDR Tropinone reductase homolog At2g29360 Arabidopsis thaliana
P25145 9e-25 102 32 7 248 3 lmo0432 Uncharacterized oxidoreductase Lmo0432 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8NBQ5 1.01e-24 102 28 2 192 1 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Homo sapiens
Q5NVG2 1.27e-24 102 28 2 192 2 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Pongo abelii
Q9EQ06 1.45e-24 102 28 2 192 1 Hsd17b11 Estradiol 17-beta-dehydrogenase 11 Mus musculus
Q5RCF8 1.48e-24 102 29 4 258 2 DHRS4 Dehydrogenase/reductase SDR family member 4 Pongo abelii
Q06136 1.55e-24 103 34 7 228 1 KDSR 3-ketodihydrosphingosine reductase Homo sapiens
P0A9P9 1.56e-24 101 28 4 260 1 idnO 5-keto-D-gluconate 5-reductase Escherichia coli (strain K12)
P0A9Q0 1.56e-24 101 28 4 260 3 idnO 5-keto-D-gluconate 5-reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6AYS8 1.58e-24 102 27 2 192 2 Hsd17b11 Estradiol 17-beta-dehydrogenase 11 Rattus norvegicus
Q9Y6Z9 1.96e-24 101 32 7 264 3 sou1 Sorbose reductase sou1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q92GE0 2.19e-24 100 33 4 255 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P9WGS7 2.19e-24 101 30 4 272 1 Rv0687 Uncharacterized NAD-dependent oxidoreductase Rv0687 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS6 2.19e-24 101 30 4 272 3 MT0715 Uncharacterized NAD-dependent oxidoreductase MT0715 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P50165 3.16e-24 100 29 4 259 2 None Tropinone reductase homolog Datura stramonium
Q42182 3.79e-24 100 30 5 257 2 At2g29300 Tropinone reductase homolog At2g29300 Arabidopsis thaliana
Q2KIJ5 3.85e-24 102 33 7 228 1 KDSR 3-ketodihydrosphingosine reductase Bos taurus
P52037 4.09e-24 100 32 7 255 1 ygfF Uncharacterized oxidoreductase YgfF Escherichia coli (strain K12)
Q920P0 4.27e-24 100 31 4 261 1 Dcxr L-xylulose reductase Rattus norvegicus
P9WGT3 4.31e-24 100 31 5 251 1 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGT2 4.31e-24 100 31 5 251 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Y5 4.31e-24 100 31 5 251 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9ZW16 4.79e-24 100 32 5 260 1 TRI Tropinone reductase homolog At2g29330 Arabidopsis thaliana
P87219 4.8e-24 100 30 6 259 1 SOU1 Sorbose reductase SOU1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P0DX40 8.45e-24 100 29 5 251 1 cla-dh CLA biosynthesis dehydrogenase/reductase Lactiplantibacillus plantarum
O80713 9.74e-24 99 31 5 263 2 SDR3a Short-chain dehydrogenase reductase 3a Arabidopsis thaliana
Q9LBV3 9.95e-24 99 28 7 269 1 barS1 A-factor type gamma-butyrolactone 1'-reductase (1S-forming) Streptomyces virginiae
Q51576 1.07e-23 99 35 7 258 3 PA3106 Uncharacterized oxidoreductase PA3106 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q92EK7 1.08e-23 99 30 6 247 3 lin0452 Uncharacterized oxidoreductase Lin0452 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O18404 1.13e-23 99 35 4 205 1 scu 3-hydroxyacyl-CoA dehydrogenase type-2 Drosophila melanogaster
Q9ZW15 1.21e-23 99 30 6 259 2 At2g29320 Tropinone reductase homolog At2g29320 Arabidopsis thaliana
O34782 1.32e-23 99 29 6 265 3 yvrD Uncharacterized oxidoreductase YvrD Bacillus subtilis (strain 168)
A0A3Q8GYY4 1.45e-23 99 31 11 266 1 NEPS2 (+)-cis,trans-nepetalactol synthase NEPS2 Nepeta racemosa
P08074 1.52e-23 98 31 5 260 1 Cbr2 Carbonyl reductase [NADPH] 2 Mus musculus
Q49WS9 1.89e-23 98 31 5 207 3 SSP1627 Uncharacterized oxidoreductase SSP1627 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q91X52 1.91e-23 98 30 4 261 1 Dcxr L-xylulose reductase Mus musculus
Q9S9W2 2.02e-23 98 34 10 266 1 SDRA Short-chain dehydrogenase/reductase SDRA Arabidopsis thaliana
H9BFQ1 2.45e-23 99 31 10 269 2 None Tropinone reductase-like 2 Erythroxylum coca
P39644 2.45e-23 98 27 2 255 1 bacG NADPH-dependent reductase BacG Bacillus subtilis (strain 168)
Q91XV4 2.59e-23 98 30 3 257 1 DCXR L-xylulose reductase Mesocricetus auratus
Q9ZW12 4.46e-23 99 28 5 260 2 At2g29260 Tropinone reductase homolog At2g29260, chloroplastic Arabidopsis thaliana
Q4JK73 4.68e-23 98 27 2 192 2 HSD17B11 Estradiol 17-beta-dehydrogenase 11 Macaca fascicularis
Q7SHI4 5.41e-23 97 30 8 275 2 srdC Short-chain dehydrogenase srdC Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q8RX32 6.22e-23 97 30 7 260 2 At1g07450 Tropinone reductase homolog At1g07450 Arabidopsis thaliana
Q5LA59 9.63e-23 96 29 4 254 1 hdhA 7alpha-hydroxysteroid dehydrogenase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
O31767 9.82e-23 96 30 6 252 3 ymfI Uncharacterized oxidoreductase YmfI Bacillus subtilis (strain 168)
F4J300 1.12e-22 96 32 5 261 3 SDR5 Short-chain dehydrogenase reductase 5 Arabidopsis thaliana
Q6CEE9 1.41e-22 96 28 5 261 1 YALI0B16192g Probable NADP-dependent mannitol dehydrogenase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q7Z4W1 1.57e-22 95 29 4 257 1 DCXR L-xylulose reductase Homo sapiens
P73826 1.67e-22 95 30 5 255 1 phaB Acetoacetyl-CoA reductase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6GV12 1.95e-22 97 32 7 228 1 Kdsr 3-ketodihydrosphingosine reductase Mus musculus
Q3T0C2 2.13e-22 95 34 5 204 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Bos taurus
P15428 2.96e-22 95 33 4 203 1 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Homo sapiens
T2KLZ8 3.16e-22 95 28 4 256 2 kduD 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q56632 4.16e-22 95 29 5 262 3 vibA Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8MJY8 4.16e-22 95 33 4 203 2 HPGD 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Macaca fascicularis
P14697 4.74e-22 94 28 3 255 1 phaB Acetoacetyl-CoA reductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9XT00 4.79e-22 95 33 4 267 3 HSD17B8 (3R)-3-hydroxyacyl-CoA dehydrogenase Sus scrofa
Q1NEI6 4.92e-22 94 28 6 253 1 LRA5 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)) Sphingomonas sp. (strain SKA58)
P39333 5.04e-22 94 30 9 256 1 bdcA Cyclic-di-GMP-binding biofilm dispersal mediator protein Escherichia coli (strain K12)
P54554 5.15e-22 94 31 5 233 3 yqjQ Uncharacterized oxidoreductase YqjQ Bacillus subtilis (strain 168)
Q4L8Y1 5.32e-22 94 31 2 190 3 SH0585 Uncharacterized oxidoreductase SH0585 Staphylococcus haemolyticus (strain JCSC1435)
H9BFQ0 6.12e-22 95 31 8 262 2 None Tropinone reductase-like 1 Erythroxylum coca
Q920N9 7.27e-22 94 30 4 261 2 DCXR L-xylulose reductase Cavia porcellus
O74470 8.07e-22 94 28 4 257 3 SPCC1739.08c Uncharacterized oxidoreductase C1739.08c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8N3Y7 8.62e-22 95 31 3 193 1 SDR16C5 Epidermal retinol dehydrogenase 2 Homo sapiens
Q68ER2 9.49e-22 93 29 6 251 2 cbr4 Carbonyl reductase family member 4 Xenopus tropicalis
Q29529 9.92e-22 94 30 5 258 1 CBR2 Carbonyl reductase [NADPH] 2 Sus scrofa
A5PJJ7 1.03e-21 95 30 4 198 2 SDR16C6 Short-chain dehydrogenase/reductase family 16C member 6 Bos taurus
P23102 1.09e-21 94 32 7 257 3 xylL 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase Pseudomonas putida
P9WGS5 1.26e-21 94 30 6 274 1 Rv2750 Uncharacterized oxidoreductase Rv2750 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGS4 1.26e-21 94 30 6 274 3 MT2820 Uncharacterized oxidoreductase MT2820 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O32291 1.4e-21 95 31 1 187 3 yxnA Uncharacterized oxidoreductase YxnA Bacillus subtilis (strain 168)
P16543 1.55e-21 93 33 10 255 3 gra-orf6 Granaticin polyketide synthase putative ketoacyl reductase 2 Streptomyces violaceoruber
O93868 1.73e-21 93 27 3 263 1 mtdH NADP-dependent mannitol dehydrogenase Agaricus bisporus
K4N0V2 1.83e-21 93 31 7 261 1 BDH Borneol dehydrogenase, mitochondrial Lavandula x intermedia
Q8KES3 2.27e-21 92 30 3 210 1 CT0609 Sepiapterin reductase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
F1QWW8 2.34e-21 94 35 5 191 1 kdsr 3-dehydrosphinganine reductase Danio rerio
Q8VCC1 2.75e-21 93 33 5 203 1 Hpgd 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Mus musculus
P71534 3e-21 92 30 6 258 1 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
F4J2Z7 3.21e-21 93 30 4 262 2 SDR4 Short-chain dehydrogenase reductase 4 Arabidopsis thaliana
P57432 4.78e-21 92 26 4 256 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P27582 4.85e-21 90 33 4 203 1 None 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) Brassica napus
Q9M1K9 4.88e-21 92 32 8 263 1 TA1 Short-chain dehydrogenase reductase ATA1 Arabidopsis thaliana
Q6NV34 4.92e-21 93 30 5 256 2 decr2 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] Danio rerio
P9WGP9 7.25e-21 92 34 2 191 2 sadH Putative oxidoreductase SadH Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGP8 7.25e-21 92 34 2 191 3 sadH Putative oxidoreductase SadH Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TQA3 1.07e-20 92 30 4 197 2 Sdr16c5 Epidermal retinol dehydrogenase 2 Mus musculus
A7IQF2 1.12e-20 90 35 5 199 3 xecE2 Inactive 2-(S)-hydroxypropyl-CoM dehydrogenase 2 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P9WES5 1.18e-20 91 32 9 258 3 fogB Short-chain dehydrogenase fogB Aspergillus ruber (strain CBS 135680)
Q7FAE1 1.18e-20 91 31 6 260 2 Os04g0179200 Momilactone A synthase Oryza sativa subsp. japonica
N4WE73 1.21e-20 90 28 7 234 3 OXI1 Dehydrogenase OXI1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q9SY73 1.45e-20 90 33 4 188 1 At1g10310 NADPH-dependent pterin aldehyde reductase Arabidopsis thaliana
A0QYC2 1.46e-20 90 33 3 257 1 dthD D-threitol dehydrogenase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q05016 1.47e-20 91 30 8 256 1 YMR226C NADP-dependent 3-hydroxy acid dehydrogenase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P71079 1.68e-20 90 28 5 255 1 fabL Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL Bacillus subtilis (strain 168)
Q1RKB7 1.73e-20 90 30 7 236 3 fabG 3-oxoacyl-[acyl-carrier-protein] reductase FabG Rickettsia bellii (strain RML369-C)
A0A8D5M6H6 1.73e-20 90 30 9 263 1 esdpF Short-chain dehydrogenase/reductase esdpF Penicillium shearii
O02691 1.83e-20 90 32 4 210 1 HSD17B10 3-hydroxyacyl-CoA dehydrogenase type-2 Bos taurus
O07399 2.1e-20 90 29 5 258 3 mabA 3-oxoacyl-[acyl-carrier-protein] reductase MabA Mycobacterium avium
B8H1Z0 2.14e-20 90 31 4 254 1 xylB D-xylose 1-dehydrogenase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9Z0 2.14e-20 90 31 4 254 1 xylB D-xylose 1-dehydrogenase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
M2ZIX7 3.55e-20 90 27 6 252 3 MYCFIDRAFT_6125 Short chain dehydrogenase MYCFIDRAFT_6125 Pseudocercospora fijiensis (strain CIRAD86)
Q22230 3.77e-20 90 30 7 258 3 decr-1.3 Probable 2,4-dienoyl-CoA reductase 3 [(3E)-enoyl-CoA-producing] Caenorhabditis elegans
A5JYX5 4.18e-20 90 28 2 195 1 dhs-3 Protein dhs-3 Caenorhabditis elegans
P50200 5.36e-20 89 29 10 261 1 None 7alpha-hydroxysteroid dehydrogenase Paraclostridium sordellii
Q5RCH8 7.81e-20 89 27 8 269 2 PECR Peroxisomal trans-2-enoyl-CoA reductase Pongo abelii
A0A1B2CTA9 8.75e-20 89 30 11 269 1 penD Short chain dehydrogenase penD Penicillium thymicola
D2WKD9 9.69e-20 88 34 7 208 1 SDR-1 Farnesol dehydrogenase Aedes aegypti
A0A3Q8GLE8 1.03e-19 89 28 10 265 1 NEPS3 (+)-cis,cis-nepetalactol synthase NEPS3 Nepeta racemosa
Q9BY49 1.05e-19 89 26 6 265 1 PECR Peroxisomal trans-2-enoyl-CoA reductase Homo sapiens
Q56318 1.08e-19 88 30 3 258 3 TM_0019 Uncharacterized oxidoreductase TM_0019 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q05A13 1.51e-19 89 27 3 195 2 Sdr16c6 Short-chain dehydrogenase/reductase family 16C member 6 Mus musculus
Q9MYP6 2.95e-19 87 30 5 252 2 HSD17B14 17-beta-hydroxysteroid dehydrogenase 14 Bos taurus
F4JZN6 3.54e-19 88 34 3 181 1 TSC10B 3-dehydrosphinganine reductase TSC10B Arabidopsis thaliana
I6Y778 4.07e-19 89 31 6 251 1 fabG4 3-oxoacyl-[acyl-carrier-protein] reductase [NADH] Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A8F5SIS3 5.96e-19 86 29 8 266 1 BDH1 (+)-borneol dehydrogenase 1 Salvia officinalis
Q9BPX1 7.6e-19 86 30 7 231 1 HSD17B14 17-beta-hydroxysteroid dehydrogenase 14 Homo sapiens
P05406 8.85e-19 86 29 9 259 3 fixR Protein FixR Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q99714 9.99e-19 85 31 4 213 1 HSD17B10 3-hydroxyacyl-CoA dehydrogenase type-2 Homo sapiens
P0AET8 1.17e-18 85 28 4 255 1 hdhA 7alpha-hydroxysteroid dehydrogenase Escherichia coli (strain K12)
P0AET9 1.17e-18 85 28 4 255 3 hdhA 7alpha-hydroxysteroid dehydrogenase Escherichia coli O157:H7
Q9WVK3 1.61e-18 86 26 7 266 2 Pecr Peroxisomal trans-2-enoyl-CoA reductase Rattus norvegicus
Q9STY8 2.04e-18 85 32 5 206 3 HSD2 11-beta-hydroxysteroid dehydrogenase-like 2 Arabidopsis thaliana
Q46381 2.12e-18 85 31 10 269 1 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Comamonas testosteroni
Q94K41 2.44e-18 85 30 8 256 2 SDR3b Short-chain dehydrogenase reductase 3b Arabidopsis thaliana
O00058 2.53e-18 84 27 4 257 2 PIG8 Probable NADP-dependent mannitol dehydrogenase Uromyces fabae
Q8NK50 3.35e-18 84 28 7 265 1 lxr1 NADP-dependent mannitol dehydrogenase Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30)
P00335 3.82e-18 84 30 5 241 1 rbtD Ribitol 2-dehydrogenase Klebsiella aerogenes
G4N290 4.48e-18 84 30 9 280 2 RED2 Short-chain dehydrogenase RED2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
O53547 4.72e-18 85 30 8 267 1 chsB1 Hydroxyacyl-CoA dehydrogenase ChsB1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
G0RNA2 5.29e-18 84 25 10 297 1 lxr4 L-xylo-3-hexulose reductase Hypocrea jecorina (strain QM6a)
Q0WRJ2 6.36e-18 84 31 5 233 1 TSC10A 3-dehydrosphinganine reductase TSC10A Arabidopsis thaliana
Q9STY7 6.47e-18 84 32 4 189 3 HSD3 11-beta-hydroxysteroid dehydrogenase-like 3 Arabidopsis thaliana
P44481 8.44e-18 84 26 7 272 1 HI_0048 Uncharacterized oxidoreductase HI_0048 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q93W57 8.72e-18 84 32 7 193 1 SOP2 11-beta-hydroxysteroid dehydrogenase A Sesamum indicum
Q70FD1 1.22e-17 83 26 8 270 1 ALX1 NADH-dependent L-xylulose reductase Ambrosiozyma monospora
P0CU00 1.26e-17 82 29 6 221 3 SPAC977.08 Uncharacterized oxidoreductase SPAC977.08 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0CU01 1.26e-17 82 29 6 221 3 SPAC1348.09 Uncharacterized oxidoreductase SPBC1348.09 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P47230 1.53e-17 83 29 8 268 3 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Rhodococcus globerulus
H1VN83 1.61e-17 82 29 8 247 1 dpchG Short chain dehydrogenase/reductase dpchG Colletotrichum higginsianum (strain IMI 349063)
P22441 2.06e-17 82 31 5 260 1 None N-acylmannosamine 1-dehydrogenase Flavobacterium sp. (strain 141-8)
Q9CQ62 2.99e-17 83 27 5 256 1 Decr1 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial Mus musculus
P9WEW9 3.3e-17 82 29 5 194 1 dpfgG Short chain dehydrogenase/reductase dpfgG Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q71R50 4.15e-17 81 29 4 194 2 DHRS11 Dehydrogenase/reductase SDR family member 11 Gallus gallus
O08756 4.41e-17 81 31 5 211 1 Hsd17b10 3-hydroxyacyl-CoA dehydrogenase type-2 Mus musculus
P9WEQ5 4.62e-17 81 29 8 259 3 olcF Short-chain dehydrogenase/reductase olcF Penicillium canescens
E3VWK2 4.93e-17 81 29 1 194 3 penF 1-deoxy-11-beta-hydroxypentalenate dehydrogenase Streptomyces exfoliatus
P37079 5.44e-17 81 28 5 269 3 sorD Sorbitol-6-phosphate 2-dehydrogenase Klebsiella pneumoniae
Q9RPT1 5.6e-17 81 29 8 270 1 rhlG Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P87218 6.33e-17 81 26 7 259 3 SOU2 Sorbose reductase homolog SOU2 Candida albicans (strain SC5314 / ATCC MYA-2876)
P50172 7.92e-17 81 29 9 245 1 Hsd11b1 11-beta-hydroxysteroid dehydrogenase 1 Mus musculus
P57793 9.67e-17 80 26 5 266 1 SAMN02910417_01454 Phloroglucinol reductase Eubacterium oxidoreducens
Q7Q732 1.28e-16 81 27 8 251 3 AGAP005532 Dehydrogenase/reductase SDR family protein 7-like Anopheles gambiae
P28845 1.41e-16 80 28 7 232 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Homo sapiens
G0RH19 1.66e-16 80 25 7 277 1 lxr3 L-xylulose reductase Hypocrea jecorina (strain QM6a)
P31808 1.9e-16 79 27 7 249 1 yciK Uncharacterized oxidoreductase YciK Escherichia coli (strain K12)
O34896 1.92e-16 80 26 6 275 2 uxuB Uncharacterized oxidoreductase UxuB Bacillus subtilis (strain 168)
O70351 2.15e-16 79 27 8 276 1 Hsd17b10 3-hydroxyacyl-CoA dehydrogenase type-2 Rattus norvegicus
Q7T2D1 2.21e-16 80 25 5 217 2 rdh10b Retinol dehydrogenase 10-B Danio rerio
Q01198 2.42e-16 80 30 1 188 3 ligD C alpha-dehydrogenase Sphingobium sp. (strain NBRC 103272 / SYK-6)
Q9LUF2 2.58e-16 80 30 7 250 2 HSD7 11-beta-hydroxysteroid dehydrogenase-like 4B Arabidopsis thaliana
P0DKC7 2.58e-16 80 30 7 250 2 HSD4 11-beta-hydroxysteroid dehydrogenase-like 4A Arabidopsis thaliana
Q6UWP2 2.93e-16 79 27 7 248 1 DHRS11 Dehydrogenase/reductase SDR family member 11 Homo sapiens
Q28IU1 3.25e-16 80 30 5 194 2 hsd17b12 Very-long-chain 3-oxoacyl-CoA reductase Xenopus tropicalis
P9WGQ5 3.56e-16 79 29 7 257 1 Rv0927c Uncharacterized oxidoreductase Rv0927c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGQ4 3.56e-16 79 29 7 257 3 MT0954 Uncharacterized oxidoreductase MT0954 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O57314 4e-16 79 31 7 229 2 HSD17B12 Very-long-chain 3-oxoacyl-CoA reductase Anas platyrhynchos
Q29608 4.1e-16 79 27 8 263 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Saimiri sciureus
Q5RA68 4.15e-16 80 27 6 263 2 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Pongo abelii
Q64591 4.45e-16 79 27 5 256 1 Decr1 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial Rattus norvegicus
G9N4B1 5.14e-16 78 29 7 263 1 virB Short-chain dehydrogenase virB Hypocrea virens (strain Gv29-8 / FGSC 10586)
Q6YN16 5.18e-16 80 30 4 192 1 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Homo sapiens
Q1MLL4 5.62e-16 78 28 7 258 1 gdh Galactitol 2-dehydrogenase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0C0Y4 6.31e-16 78 28 9 265 1 None NADP-dependent mannitol dehydrogenase Alternaria alternata
Q9LUE4 6.46e-16 79 33 6 193 2 HSD6 11-beta-hydroxysteroid dehydrogenase-like 6 Arabidopsis thaliana
Q6R0J2 6.76e-16 79 29 7 232 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Mesocricetus auratus
C5FTN0 7.07e-16 78 28 9 264 3 easD Chanoclavine-I dehydrogenase easD Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
O32229 7.14e-16 78 26 5 265 3 yvaG Uncharacterized oxidoreductase YvaG Bacillus subtilis (strain 168)
Q6DCT3 7.64e-16 79 25 6 222 2 rdh10-a Retinol dehydrogenase 10-A Xenopus laevis
P0DKC6 9.04e-16 79 31 5 193 1 HSD1 11-beta-hydroxysteroid dehydrogenase 1B Arabidopsis thaliana
P0DKC5 9.04e-16 79 31 5 193 1 HSD1 11-beta-hydroxysteroid dehydrogenase 1A Arabidopsis thaliana
Q6F7B8 1.3e-15 78 28 2 190 1 acr1 Fatty acyl-CoA reductase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P51659 1.35e-15 79 33 2 191 1 HSD17B4 Peroxisomal multifunctional enzyme type 2 Homo sapiens
Q01373 1.52e-15 79 32 6 240 1 fox-2 Peroxisomal hydratase-dehydrogenase-epimerase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q01373 3e-10 63 28 9 249 1 fox-2 Peroxisomal hydratase-dehydrogenase-epimerase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A0A165U5V5 1.6e-15 77 27 8 266 1 ADH1 Short chain aldehyde dehydrogenase 1 Euphorbia lathyris
Q9P7B4 1.8e-15 77 28 7 237 1 SPAC521.03 NADP-dependent 3-hydroxy acid dehydrogenase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P16232 1.87e-15 77 29 9 245 1 Hsd11b1 11-beta-hydroxysteroid dehydrogenase 1 Rattus norvegicus
Q3ZBV9 2.12e-15 77 26 7 248 2 DHRS11 Dehydrogenase/reductase SDR family member 11 Bos taurus
Q8LKV5 2.28e-15 78 27 9 275 1 SOP3 11-beta-hydroxysteroid dehydrogenase B Sesamum indicum
P13859 2.71e-15 77 29 10 270 1 todD Cis-toluene dihydrodiol dehydrogenase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P08088 2.71e-15 77 29 10 270 3 bnzE Cis-1,2-dihydrobenzene-1,2-diol dehydrogenase Pseudomonas putida
Q9GME3 2.8e-15 73 38 2 144 2 HSD17B8 Estradiol 17-beta-dehydrogenase 8 (Fragment) Callithrix jacchus
Q2TPA8 3.21e-15 78 29 4 192 1 Hsdl2 Hydroxysteroid dehydrogenase-like protein 2 Mus musculus
Q3U0B3 5.17e-15 75 27 8 248 1 Dhrs11 Dehydrogenase/reductase SDR family member 11 Mus musculus
Q7M3I4 5.38e-15 76 31 7 225 1 HSD11B1 11-beta-hydroxysteroid dehydrogenase 1 Oryctolagus cuniculus
Q6P3L6 5.69e-15 76 30 6 196 2 hsd17b12a Very-long-chain 3-oxoacyl-CoA reductase-A Danio rerio
P06235 6.15e-15 75 26 5 254 3 nodG Nodulation protein G Rhizobium meliloti
Q5XGF7 6.22e-15 76 25 7 222 2 rdh10 Retinol dehydrogenase 10 Xenopus tropicalis
P40747 6.4e-15 77 29 8 265 3 yuxG Uncharacterized oxidoreductase YuxG Bacillus subtilis (strain 168)
P50203 6.52e-15 75 30 4 253 3 phaB Acetoacetyl-CoA reductase Acinetobacter sp. (strain RA3849)
P50166 6.53e-15 75 25 6 269 1 ARD D-arabinitol 2-dehydrogenase [ribulose-forming] Candida tropicalis
Q82IY9 6.7e-15 75 29 3 198 1 ptlF 1-deoxy-11-beta-hydroxypentalenate dehydrogenase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A3F5F0 7.09e-15 75 28 9 238 1 SDH Secoisolariciresinol dehydrogenase Sinopodophyllum hexandrum
O08699 8.08e-15 75 33 4 203 1 Hpgd 15-hydroxyprostaglandin dehydrogenase [NAD(+)] Rattus norvegicus
O54939 8.25e-15 75 27 6 198 2 Hsd17b3 17-beta-hydroxysteroid dehydrogenase type 3 Rattus norvegicus
P25970 1.01e-14 75 26 1 190 3 MXAN_5909 Uncharacterized oxidoreductase MXAN_5909 Myxococcus xanthus (strain DK1622)
Q8HZJ8 1.11e-14 75 28 7 244 1 None 11-beta-hydroxysteroid dehydrogenase 1 Bos taurus
A4FUZ6 1.11e-14 76 28 4 192 2 HSDL2 Hydroxysteroid dehydrogenase-like protein 2 Bos taurus
Q9FYL6 1.12e-14 75 29 8 245 2 KCR2 Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 Arabidopsis thaliana
O34308 1.13e-14 74 25 7 254 3 ytkK Putative oxidoreductase YtkK Bacillus subtilis (strain 168)
Q9Y140 1.27e-14 75 27 7 234 2 CG7601 Dehydrogenase/reductase SDR family protein 7-like Drosophila melanogaster
Q99L04 1.28e-14 75 28 9 252 1 Dhrs1 Dehydrogenase/reductase SDR family member 1 Mus musculus
P72220 1.42e-14 74 28 7 267 3 bphB Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Pseudomonas putida
Q96LJ7 1.67e-14 75 29 8 251 1 DHRS1 Dehydrogenase/reductase SDR family member 1 Homo sapiens
Q4V8F9 1.79e-14 75 29 4 192 2 Hsdl2 Hydroxysteroid dehydrogenase-like protein 2 Rattus norvegicus
A0A140FAN3 1.79e-14 75 29 5 196 1 None 11-beta-hydroxysteroid dehydrogenase Pinus massoniana
A7LB60 1.82e-14 75 30 6 192 1 STO-A 11-beta-hydroxysteroid dehydrogenase A Arachis hypogaea
A6SSW9 2.22e-14 74 28 3 187 2 BOA17 Oxidoreductase BOA17 Botryotinia fuckeliana (strain B05.10)
P37058 2.47e-14 74 26 5 193 1 HSD17B3 17-beta-hydroxysteroid dehydrogenase type 3 Homo sapiens
P50167 2.84e-14 73 24 5 269 2 ARDH D-arabinitol 2-dehydrogenase [ribulose-forming] Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q9Y394 3.04e-14 74 29 3 195 1 DHRS7 Dehydrogenase/reductase SDR family member 7 Homo sapiens
Q94KL8 3.26e-14 73 28 8 238 1 None Secoisolariciresinol dehydrogenase (Fragment) Podophyllum peltatum
Q8A945 4.37e-14 73 29 5 204 1 kdsr 3-ketodihydrosphingosine reductase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_06455
Feature type CDS
Gene fabG
Product NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Location 92155 - 92934 (strand: -1)
Length 780 (nucleotides) / 259 (amino acids)

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_877
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00106 short chain dehydrogenase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1028 Lipid transport and metabolism (I) I NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03366 meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304] Butanoate metabolism
Biosynthesis of secondary metabolites		 -

Protein Sequence

MALTGKVVLVTGAAQGIGRGIALRLAKEGADIALVDLKEEGLAKVKKEVEALGRKAAVFTADISQRDQVFAVVDKAEQALGGFDVIVNNAGIAQVKAIEDVLPEDMDRIFRINVDGTMWGIQAAAAKFKARGQKGKIINASSIAGHDGFALLGVYSATKFAVRALTQAAAKEFASSGITVNAYCPGIVGTDMWVEIDERFSEITGAPKGETYKKYVDGIALGRAQTPDDVAALVAFLASDDSDYITGQAILTDGGIVYR

Flanking regions ( +/- flanking 50bp)

AAATGAGTATTAATATCATAACGAAATACCTCACTCATAAGGAGCACATCATGGCACTAACGGGTAAAGTGGTTCTGGTCACCGGCGCTGCACAGGGGATTGGTCGTGGTATTGCACTGCGCTTAGCCAAAGAAGGGGCGGATATCGCGCTGGTGGATCTGAAAGAAGAAGGGCTGGCGAAAGTCAAAAAAGAAGTGGAAGCCCTGGGCCGCAAAGCGGCGGTATTCACTGCGGATATCAGTCAGCGCGATCAGGTTTTTGCGGTTGTTGATAAAGCAGAACAAGCATTGGGCGGTTTTGATGTTATCGTCAATAACGCCGGTATTGCACAGGTTAAAGCCATTGAAGATGTGCTGCCGGAGGATATGGATCGTATTTTCCGCATTAACGTCGATGGTACGATGTGGGGAATTCAGGCCGCAGCGGCCAAATTCAAAGCACGCGGACAGAAAGGGAAAATCATTAACGCCTCATCCATTGCCGGGCATGATGGTTTTGCCTTACTCGGCGTCTATTCCGCCACTAAATTTGCGGTCCGCGCACTGACACAGGCGGCGGCCAAAGAGTTTGCCAGCAGCGGGATCACCGTGAATGCTTACTGTCCGGGGATTGTCGGCACAGATATGTGGGTGGAAATTGATGAACGTTTCTCTGAAATCACCGGCGCGCCGAAAGGGGAAACCTACAAAAAATATGTTGATGGTATTGCGCTGGGCCGCGCCCAGACTCCGGATGACGTGGCGGCACTGGTTGCCTTCCTGGCCAGCGACGACTCGGATTACATCACCGGCCAGGCGATTCTGACCGACGGCGGTATTGTTTACCGCTAAATTACTGCGTTGCTATTCACAGACATCCGCCGCATGCTGAATGCGGCGGA