Homologs in group_758

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03390 FBDBKF_03390 100.0 Morganella morganii S1 marR DNA-binding transcriptional regulator, MarR family
EHELCC_07145 EHELCC_07145 100.0 Morganella morganii S2 marR DNA-binding transcriptional regulator, MarR family
NLDBIP_07470 NLDBIP_07470 100.0 Morganella morganii S4 marR DNA-binding transcriptional regulator, MarR family
LHKJJB_07005 LHKJJB_07005 100.0 Morganella morganii S3 marR DNA-binding transcriptional regulator, MarR family
F4V73_RS11505 F4V73_RS11505 79.3 Morganella psychrotolerans - MarR family winged helix-turn-helix transcriptional regulator
PMI_RS17975 PMI_RS17975 21.5 Proteus mirabilis HI4320 - MarR family transcriptional regulator

Distribution of the homologs in the orthogroup group_758

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_758

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B2U2E2 0.001 40 22 1 104 3 slyA Transcriptional regulator SlyA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03925
Feature type CDS
Gene marR
Product DNA-binding transcriptional regulator, MarR family
Location 101679 - 102116 (strand: -1)
Length 438 (nucleotides) / 145 (amino acids)

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_758
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12802 MarR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1846 Transcription (K) K DNA-binding transcriptional regulator, MarR family

Protein Sequence

MKIALNDLDFIDLISERHTLLRERIDALWNVRSEIHMSNSEWYILSRVYDQPVSIADISATVTISRQAIHKFIRQMEEKGLITIFDVQGSKKLKGVKMTPHGQQCYDAYEAIKTGLCDEIGAAVGQDNLALIIRLFQQPWFDEKR

Flanking regions ( +/- flanking 50bp)

AGTTGACGAAGTGTTTTTGGTATACTGCACAAAAAGGAAAGGGGGAGCGCGTGAAAATTGCATTAAACGACCTGGATTTTATTGACCTTATCAGTGAGCGGCACACACTGCTCCGTGAGCGGATTGATGCGCTCTGGAATGTCCGGAGCGAAATTCACATGAGTAATTCGGAGTGGTACATTTTATCGAGGGTGTATGACCAGCCGGTATCCATAGCTGATATTTCCGCGACAGTGACCATCTCCCGCCAGGCGATTCATAAATTCATCCGACAGATGGAAGAAAAGGGATTAATCACCATCTTTGATGTTCAGGGCAGTAAAAAGCTCAAGGGGGTGAAAATGACACCGCACGGGCAGCAATGCTATGACGCCTATGAAGCCATCAAAACCGGATTGTGTGATGAAATTGGCGCCGCTGTCGGACAGGACAATCTCGCGCTGATCATCCGGTTATTTCAGCAGCCCTGGTTTGATGAAAAACGGTAACGCCTTTTCTGCTGCTCAGAAAAGGTGTTTTTGTTCAGGCGGCAGCGATA