Homologs in group_2622

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03390 FBDBKF_03390 79.3 Morganella morganii S1 marR DNA-binding transcriptional regulator, MarR family
EHELCC_07145 EHELCC_07145 79.3 Morganella morganii S2 marR DNA-binding transcriptional regulator, MarR family
NLDBIP_07470 NLDBIP_07470 79.3 Morganella morganii S4 marR DNA-binding transcriptional regulator, MarR family
LHKJJB_07005 LHKJJB_07005 79.3 Morganella morganii S3 marR DNA-binding transcriptional regulator, MarR family
HKOGLL_03925 HKOGLL_03925 79.3 Morganella morganii S5 marR DNA-binding transcriptional regulator, MarR family

Distribution of the homologs in the orthogroup group_2622

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2622

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11505
Feature type CDS
Gene -
Product MarR family winged helix-turn-helix transcriptional regulator
Location 449390 - 449827 (strand: 1)
Length 438 (nucleotides) / 145 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2622
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13463 Winged helix DNA-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1846 Transcription (K) K DNA-binding transcriptional regulator, MarR family

Protein Sequence

MKIALNELDFVDLISERHTLLRERIDTCWNAQSKIRMGTSEWYILSRISDQPVSIATISATVTISRQAIHKFIRQLEEKGLITVFDLQDSKKLKGVKMTAHGQRCYDAYEAIKVSLCDEIGAAIGHENVALMTRLLQQPWFGEKA

Flanking regions ( +/- flanking 50bp)

TTGACGTGGTGTTTTTGCTATACTGCACAAAAAAGAAAAGGGGTGGCTGAGTGAAAATTGCGTTGAATGAACTGGATTTCGTCGATTTAATCAGTGAGCGGCACACATTGCTCCGTGAGCGGATAGATACCTGCTGGAATGCACAGAGTAAGATCCGCATGGGAACATCGGAATGGTATATCCTCTCAAGGATTAGTGATCAGCCGGTGTCCATTGCGACTATTTCTGCGACTGTCACTATCTCCCGCCAGGCTATTCATAAATTTATCCGTCAGCTGGAAGAAAAAGGGCTGATTACGGTTTTTGATTTGCAGGACAGTAAAAAACTGAAAGGCGTCAAAATGACCGCACACGGGCAGCGGTGCTATGACGCGTACGAAGCCATCAAAGTTTCACTGTGTGATGAGATAGGCGCGGCAATCGGGCATGAGAATGTCGCCCTCATGACCCGGTTATTGCAGCAGCCCTGGTTCGGGGAAAAAGCGTGATGTATCTGTTACGGGCAGACGACATCACTGTATGTCAGTGTCAGGCTGGT