Homologs in group_3164

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00450 FBDBKF_00450 100.0 Morganella morganii S1 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
EHELCC_01095 EHELCC_01095 100.0 Morganella morganii S2 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
NLDBIP_02365 NLDBIP_02365 100.0 Morganella morganii S4 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
LHKJJB_03880 LHKJJB_03880 100.0 Morganella morganii S3 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain

Distribution of the homologs in the orthogroup group_3164

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3164

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q06758 9.29e-54 177 39 1 223 3 hisJ Probable histidine-binding protein Neisseria gonorrhoeae
P0AEQ3 2.02e-30 116 34 6 234 1 glnH Glutamine-binding periplasmic protein Escherichia coli (strain K12)
P0AEQ4 2.02e-30 116 34 6 234 3 glnH Glutamine-binding periplasmic protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ5 2.02e-30 116 34 6 234 3 glnH Glutamine-binding periplasmic protein Escherichia coli O157:H7
P30859 8.15e-30 115 31 6 249 1 artI Putative ABC transporter arginine-binding protein 2 Escherichia coli (strain K12)
P30860 3.4e-29 113 31 5 248 1 artJ ABC transporter arginine-binding protein 1 Escherichia coli (strain K12)
P0AEU0 6.33e-25 102 29 3 228 1 hisJ Histidine-binding periplasmic protein Escherichia coli (strain K12)
P0AEU1 6.33e-25 102 29 3 228 3 hisJ Histidine-binding periplasmic protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU2 6.33e-25 102 29 3 228 3 hisJ Histidine-binding periplasmic protein Escherichia coli O157:H7
P02911 1.03e-24 102 28 5 259 1 argT Lysine/arginine/ornithine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEM9 1.1e-24 102 30 5 230 1 tcyJ L-cystine-binding protein TcyJ Escherichia coli (strain K12)
P0AEN0 1.1e-24 102 30 5 230 3 tcyJ L-cystine-binding protein TcyJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P02910 3.69e-24 100 28 3 228 1 hisJ Histidine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
G3XD47 5.96e-24 100 29 4 245 1 aotJ L-arginine-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P09551 7.88e-24 99 27 4 252 1 argT Lysine/arginine/ornithine-binding periplasmic protein Escherichia coli (strain K12)
P54535 1.08e-22 96 27 4 248 1 artP Arginine-binding extracellular protein ArtP Bacillus subtilis (strain 168)
P45091 1.29e-19 87 31 6 217 1 artI ABC transporter arginine-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O34563 1.51e-19 88 31 6 227 2 glnH ABC transporter glutamine-binding protein GlnH Bacillus subtilis (strain 168)
P49618 3.57e-19 86 27 4 238 3 lapT Arginine-binding periplasmic protein Mannheimia haemolytica
P35120 3.18e-18 85 24 7 266 1 nocT Nopaline-binding periplasmic protein Agrobacterium fabrum (strain C58 / ATCC 33970)
P45024 4.32e-18 84 27 7 269 1 HI_1080 Probable amino-acid ABC transporter-binding protein HI_1080 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42199 5.77e-17 81 26 5 242 1 tcyA L-cystine-binding protein TcyA Bacillus subtilis (strain 168)
P39906 2.35e-16 79 23 4 256 3 aabA Amino-acid-binding protein AabA Dichelobacter nodosus
A8ZWR8 8.3e-16 79 25 3 202 3 mltF Membrane-bound lytic murein transglycosylase F Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
P54952 2.99e-15 76 27 5 226 1 yxeM Probable amino-acid-binding protein YxeM Bacillus subtilis (strain 168)
Q8ZPA3 1.51e-14 74 28 1 132 1 dalS ABC transporter D-alanine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A4F8 3.39e-14 73 23 5 268 1 occT Octopine-binding periplasmic protein Rhizobium radiobacter
P0A4F9 3.39e-14 73 23 5 268 3 occT Octopine-binding periplasmic protein Agrobacterium tumefaciens (strain Ach5)
Q46125 5.88e-14 72 23 5 222 1 hisJ Probable histidine-binding protein Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P52626 3.06e-13 70 27 5 231 3 patH Putative amino-acid ABC transporter-binding protein PatH Vibrio harveyi
Q9Z869 3.5e-13 70 22 4 251 1 artJ Probable ABC transporter arginine-binding protein ArtJ Chlamydia pneumoniae
P72298 3.14e-12 68 20 5 286 3 occT Octopine-binding periplasmic protein Rhizobium meliloti
O84385 1.17e-11 66 25 8 254 1 artJ Probable ABC transporter arginine-binding protein ArtJ Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q8RQL6 1.3e-10 63 24 7 214 3 gluB Glutamate-binding protein GluB Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P27676 3.63e-10 62 28 5 194 3 glnH Glutamine-binding protein Geobacillus stearothermophilus
P48242 1.17e-08 58 22 7 223 1 gluB Glutamate-binding protein GluB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q0P9X8 1.23e-08 57 25 4 182 1 peb1A Major cell-binding factor Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1VZQ4 1.79e-08 57 25 4 182 3 peb1A Major cell-binding factor Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P42400 1.32e-07 55 23 7 242 1 yckB Probable ABC transporter extracellular-binding protein YckB Bacillus subtilis (strain 168)
Q01269 5.58e-07 52 21 3 176 1 pheC Cyclohexadienyl dehydratase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0AQY9 1.11e-06 52 23 7 214 3 mltF Membrane-bound lytic murein transglycosylase F Maricaulis maris (strain MCS10)
Q9ULK0 2.04e-06 52 31 2 119 1 GRID1 Glutamate receptor ionotropic, delta-1 Homo sapiens
Q62640 2.03e-05 48 31 2 119 1 Grid1 Glutamate receptor ionotropic, delta-1 Rattus norvegicus
Q61627 2.27e-05 48 31 2 119 1 Grid1 Glutamate receptor ionotropic, delta-1 Mus musculus
P26591 6.38e-05 47 34 2 88 2 None Glutamate receptor Lymnaea stagnalis
Q5IS46 0.000107 47 30 2 82 2 GRIK4 Glutamate receptor ionotropic, kainate 4 Pan troglodytes
Q8BMF5 0.000107 47 30 2 82 1 Grik4 Glutamate receptor ionotropic, kainate 4 Mus musculus
Q16099 0.000107 47 30 2 82 1 GRIK4 Glutamate receptor ionotropic, kainate 4 Homo sapiens
Q01812 0.000174 46 31 1 73 1 Grik4 Glutamate receptor ionotropic, kainate 4 Rattus norvegicus
Q8NQU2 0.000257 45 29 0 77 1 argT Arginine-binding protein ArgT Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q5QWY4 0.000288 45 24 5 197 3 mltF Membrane-bound lytic murein transglycosylase F Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q47XX8 0.000301 45 22 1 119 3 mltF Membrane-bound lytic murein transglycosylase F Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0A9W6 0.000331 45 28 3 107 3 mltF1 Membrane-bound lytic murein transglycosylase F 1 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
O60391 0.000736 44 28 2 92 1 GRIN3B Glutamate receptor ionotropic, NMDA 3B Homo sapiens
Q02482 0.000785 44 20 6 233 3 Sfri_3689 Putative sensor protein Sfri_3689 Shewanella frigidimarina (strain NCIMB 400)
Q90218 0.000792 43 25 1 88 2 KBP Probable glutamate receptor Anas platyrhynchos
O34406 0.001 43 21 9 245 1 tcyJ L-cystine-binding protein TcyJ Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03165
Feature type CDS
Gene hisJ
Product ABC-type amino acid transport/signal transduction system, periplasmic component/domain
Location 240578 - 241345 (strand: -1)
Length 768 (nucleotides) / 255 (amino acids)

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3164
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00497 Bacterial extracellular solute-binding proteins, family 3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0834 Amino acid transport and metabolism (E)
Signal transduction mechanisms (T)		 ET ABC-type amino acid transport/signal transduction system, periplasmic component/domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02030 polar amino acid transport system substrate-binding protein - -

Protein Sequence

MFKKLVFAGCLSLLAFTGVSQAKETYVVGAGGTYRPFEFENSEKQLEGFDIDIIKAVAAAEDFDVKLINTPWEGIFATLSAGDRDILISGITITDKRKQMVDFSAPYFPAEQAIVVNENSPISALSELSKYNVGVVNSSTGDIVVSDVLGKTSTAIKRFDNTPLLLQELYEDGVDAAVGDVGVVKFYIKTHPDKKFKLIYDNHFEKQYFGIAVAKGNTELQEKINRGLAKIIADGTYAKIYQKWFDNDVPSLPAQ

Flanking regions ( +/- flanking 50bp)

GAATATTTATGTATTTTTAATTAAAAATCACGCATAAAAATGAGGTTGTCATGTTTAAAAAATTAGTCTTTGCAGGCTGTTTATCATTATTAGCATTCACCGGGGTAAGCCAGGCCAAAGAAACCTATGTGGTCGGTGCCGGCGGTACCTATCGCCCGTTTGAATTTGAAAACAGTGAAAAACAACTCGAAGGGTTTGATATCGATATTATCAAAGCGGTTGCTGCCGCCGAAGATTTTGACGTCAAATTAATCAACACGCCGTGGGAAGGTATTTTCGCCACACTGTCCGCCGGGGATCGCGATATTTTAATTTCCGGTATTACCATCACCGATAAACGCAAACAGATGGTGGATTTCTCCGCCCCGTATTTCCCGGCGGAACAGGCAATTGTGGTGAATGAAAATTCACCAATCAGCGCGTTATCTGAACTGAGTAAATATAATGTCGGTGTGGTGAACTCCAGCACCGGGGATATTGTGGTTTCTGATGTGCTCGGCAAAACCAGCACCGCCATCAAACGCTTTGATAATACTCCGCTGCTGTTACAGGAATTATATGAAGACGGCGTGGATGCGGCGGTCGGTGATGTCGGTGTCGTGAAGTTTTATATTAAAACCCATCCGGATAAGAAATTTAAACTGATTTACGACAATCATTTTGAAAAACAGTATTTCGGCATTGCGGTTGCCAAAGGTAATACGGAATTACAGGAAAAAATTAACCGTGGTCTGGCAAAAATCATTGCCGACGGTACTTACGCCAAAATCTATCAGAAATGGTTCGATAACGACGTACCTTCCCTGCCCGCGCAGTAATTCATTATTTATCTGATTAAAAACCCGCTCCTGCGGCGGGTTTGATCTGT