Homologs in group_2516

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01380 FBDBKF_01380 100.0 Morganella morganii S1 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
EHELCC_00165 EHELCC_00165 100.0 Morganella morganii S2 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
NLDBIP_03295 NLDBIP_03295 100.0 Morganella morganii S4 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
LHKJJB_04810 LHKJJB_04810 100.0 Morganella morganii S3 gloA Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
F4V73_RS02050 F4V73_RS02050 77.8 Morganella psychrotolerans - VOC family protein

Distribution of the homologs in the orthogroup group_2516

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2516

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8GPH6 7.27e-14 66 32 2 121 1 ehpR Phenazine antibiotic resistance protein EhpR Enterobacter agglomerans
A7Z3A4 0.000526 40 26 4 112 3 fosB Metallothiol transferase FosB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_02235
Feature type CDS
Gene gloA
Product Catechol 2,3-dioxygenase or related enzyme, vicinal oxygen chelate (VOC) family
Location 36851 - 37231 (strand: -1)
Length 381 (nucleotides) / 126 (amino acids)
In genomic island -

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2516
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00903 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3607 General function prediction only (R) R Lactoylglutathione lyase-related enzyme, vicinal oxygen chelate (VOC) family

Protein Sequence

MFKPNSIILYVSDVEKSTRFYTRLLNAEPVEQYSEFSVFALSDDMILGLQAKSGIDPAPQPHIGGTEICMSDISNREIDEIFRKWSELGVEIIMKPAMLDFGYTFVATDPDGHRLRVCATDTTNID

Flanking regions ( +/- flanking 50bp)

AATTTCTGTCATTCAACGGGGCTATGATATGAAAAACCACAGGAGGCAGCATGTTTAAACCAAACAGCATTATTCTGTACGTCAGCGACGTTGAGAAAAGTACCCGTTTTTACACCAGACTTCTTAATGCAGAGCCTGTTGAACAATACAGTGAATTTTCTGTTTTTGCCTTATCGGACGATATGATATTAGGACTTCAGGCAAAATCCGGTATCGACCCTGCACCACAACCACATATTGGCGGTACGGAAATATGCATGTCAGATATCAGTAACCGGGAAATTGATGAGATTTTCCGCAAATGGAGTGAACTGGGAGTGGAGATTATTATGAAACCCGCAATGCTGGATTTCGGCTACACTTTCGTGGCAACCGACCCCGACGGACATCGCCTGAGAGTCTGTGCGACTGACACCACAAATATTGATTGATGATAATCTGTGATCTGAAAAAATAACAGGGAATACACTCCCTGTTATTT