Homologs in group_706

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02050 FBDBKF_02050 100.0 Morganella morganii S1 tACO1 YebC/PmpR family DNA-binding transcriptional regulator
EHELCC_02520 EHELCC_02520 100.0 Morganella morganii S2 tACO1 YebC/PmpR family DNA-binding transcriptional regulator
NLDBIP_00940 NLDBIP_00940 100.0 Morganella morganii S4 tACO1 YebC/PmpR family DNA-binding transcriptional regulator
LHKJJB_01095 LHKJJB_01095 100.0 Morganella morganii S3 tACO1 YebC/PmpR family DNA-binding transcriptional regulator
F4V73_RS04415 F4V73_RS04415 95.1 Morganella psychrotolerans - YebC/PmpR family DNA-binding transcriptional regulator
PMI_RS05400 PMI_RS05400 89.5 Proteus mirabilis HI4320 - YebC/PmpR family DNA-binding transcriptional regulator

Distribution of the homologs in the orthogroup group_706

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_706

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETP5 1.54e-164 457 89 0 247 3 PMI1113 Probable transcriptional regulatory protein PMI1113 Proteus mirabilis (strain HI4320)
Q7N550 1.23e-163 455 88 0 247 3 plu2109 Probable transcriptional regulatory protein plu2109 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DFE9 2.23e-161 449 87 0 247 3 PC1_1817 Probable transcriptional regulatory protein PC1_1817 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D499 8.4e-160 445 85 0 247 3 ECA2494 Probable transcriptional regulatory protein ECA2494 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JRK5 1.18e-157 440 84 0 247 3 YE2395 Probable transcriptional regulatory protein YE2395 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9QYX6 5.19e-157 438 84 0 247 3 YpAngola_A2424 Probable transcriptional regulatory protein YpAngola_A2424 Yersinia pestis bv. Antiqua (strain Angola)
B2K321 5.19e-157 438 84 0 247 3 YPTS_2097 Probable transcriptional regulatory protein YPTS_2097 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q8ZEU8 5.19e-157 438 84 0 247 3 YPO2055 Probable transcriptional regulatory protein YPO2055/y2255/YP_1898 Yersinia pestis
Q66AU2 5.19e-157 438 84 0 247 3 YPTB2038 Probable transcriptional regulatory protein YPTB2038 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FIC8 5.19e-157 438 84 0 247 3 YpsIP31758_2033 Probable transcriptional regulatory protein YpsIP31758_2033 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CJG8 5.19e-157 438 84 0 247 3 YPN_1532 Probable transcriptional regulatory protein YPN_1532 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1C818 5.19e-157 438 84 0 247 3 YPA_1437 Probable transcriptional regulatory protein YPA_1437 Yersinia pestis bv. Antiqua (strain Antiqua)
A4TJK3 5.19e-157 438 84 0 247 3 YPDSF_1067 Probable transcriptional regulatory protein YPDSF_1067 Yersinia pestis (strain Pestoides F)
C5B9S9 8.44e-157 438 85 0 247 3 NT01EI_1596 Probable transcriptional regulatory protein NT01EI_1596 Edwardsiella ictaluri (strain 93-146)
B1JLL3 2.55e-156 436 83 0 247 3 YPK_2146 Probable transcriptional regulatory protein YPK_2146 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B2VJ92 8.05e-156 435 83 0 247 3 ETA_14870 Probable transcriptional regulatory protein ETA_14870 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GFJ0 2.44e-154 431 81 0 247 3 Spro_2779 Probable transcriptional regulatory protein Spro_2779 Serratia proteamaculans (strain 568)
A6TB33 2.51e-153 429 83 1 247 3 KPN78578_23430 Probable transcriptional regulatory protein KPN78578_23430 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQ02 2.51e-153 429 83 1 247 3 KPK_1906 Probable transcriptional regulatory protein KPK_1906 Klebsiella pneumoniae (strain 342)
A7MEB8 1.06e-151 425 82 1 247 3 ESA_01378 Probable transcriptional regulatory protein ESA_01378 Cronobacter sakazakii (strain ATCC BAA-894)
P67179 4.84e-151 423 81 1 247 3 yebC Probable transcriptional regulatory protein YebC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67180 4.84e-151 423 81 1 247 3 yebC Probable transcriptional regulatory protein YebC Salmonella typhi
Q5PMZ4 4.84e-151 423 81 1 247 3 yebC Probable transcriptional regulatory protein YebC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A4WBM1 7.94e-151 422 82 1 247 3 Ent638_2432 Probable transcriptional regulatory protein Ent638_2432 Enterobacter sp. (strain 638)
A8AFH7 1.62e-150 422 81 1 247 3 CKO_01097 Probable transcriptional regulatory protein CKO_01097 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q57N98 2.99e-150 421 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Salmonella choleraesuis (strain SC-B67)
Q3Z2M2 3.52e-150 421 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Shigella sonnei (strain Ss046)
P0A8A1 3.52e-150 421 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Shigella flexneri
P0A8A0 3.52e-150 421 80 1 247 1 yebC Probable transcriptional regulatory protein YebC Escherichia coli (strain K12)
Q1RAS0 5.23e-150 421 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Escherichia coli (strain UTI89 / UPEC)
P67175 5.23e-150 421 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGW8 5.23e-150 421 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P67176 5.23e-150 421 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Escherichia coli O157:H7
Q32H97 9.05e-150 420 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Shigella dysenteriae serotype 1 (strain Sd197)
Q322D6 1.58e-149 419 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Shigella boydii serotype 4 (strain Sb227)
A9MND4 6.53e-149 418 80 1 247 3 yebC Probable transcriptional regulatory protein YebC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q2NTJ1 6.6e-149 418 80 0 247 3 SG1259 Probable transcriptional regulatory protein SG1259 Sodalis glossinidius (strain morsitans)
C4K4U6 5.97e-137 388 72 0 247 3 HDEF_0869 Probable transcriptional regulatory protein HDEF_0869 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A4SPN4 2.38e-136 386 74 1 247 3 ASA_2843 Probable transcriptional regulatory protein ASA_2843 Aeromonas salmonicida (strain A449)
Q6LT52 5.22e-133 377 72 0 247 3 PBPRA1113 Probable transcriptional regulatory protein PBPRA1113 Photobacterium profundum (strain SS9)
A6VQA7 9.22e-133 377 73 0 247 3 Asuc_1803 Probable transcriptional regulatory protein Asuc_1803 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65UP3 3.75e-132 375 72 0 247 3 MS0710 Probable transcriptional regulatory protein MS0710 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8EEF0 2.19e-130 371 72 0 243 3 SO_2432 Probable transcriptional regulatory protein SO_2432 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0UVY2 3.06e-130 370 71 1 247 3 HSM_1763 Probable transcriptional regulatory protein HSM_1763 Histophilus somni (strain 2336)
A0KIF9 4.16e-130 370 73 1 247 3 AHA_1522 Probable transcriptional regulatory protein AHA_1522 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7VNF3 9.35e-130 369 70 1 247 3 HD_0596 Probable transcriptional regulatory protein HD_0596 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q0I244 1.34e-129 369 70 1 247 3 HS_0508 Probable transcriptional regulatory protein HS_0508 Histophilus somni (strain 129Pt)
A5UGD1 2.01e-129 369 70 1 247 3 CGSHiGG_04390 Probable transcriptional regulatory protein CGSHiGG_04390 Haemophilus influenzae (strain PittGG)
Q4QNM3 2.01e-129 369 70 1 247 3 NTHI0433 Probable transcriptional regulatory protein NTHI0433 Haemophilus influenzae (strain 86-028NP)
P44634 2.01e-129 369 70 1 247 1 HI_0315 Probable transcriptional regulatory protein HI_0315 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UAH5 2.01e-129 369 70 1 247 3 CGSHiEE_01480 Probable transcriptional regulatory protein CGSHiEE_01480 Haemophilus influenzae (strain PittEE)
B0BQ92 5.52e-129 367 70 1 247 3 APJL_1171 Probable transcriptional regulatory protein APJL_1171 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B8F5G8 7.18e-129 367 71 1 247 3 HAPS_0943 Probable transcriptional regulatory protein HAPS_0943 Glaesserella parasuis serovar 5 (strain SH0165)
B3GY39 7.58e-129 367 70 1 247 3 APP7_1210 Probable transcriptional regulatory protein APP7_1210 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1F5 7.58e-129 367 70 1 247 3 APL_1151 Probable transcriptional regulatory protein APL_1151 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CM61 4.72e-128 365 69 1 247 3 PM0980 Probable transcriptional regulatory protein PM0980 Pasteurella multocida (strain Pm70)
C4LBN3 2.16e-126 361 73 1 247 3 Tola_2714 Probable transcriptional regulatory protein Tola_2714 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3K7V7 2.38e-117 338 66 0 247 3 Pfl01_4410 Probable transcriptional regulatory protein Pfl01_4410 Pseudomonas fluorescens (strain Pf0-1)
Q02IC6 5.01e-117 337 66 0 247 3 PA14_51810 Probable transcriptional regulatory protein PA14_51810 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UXW8 5.01e-117 337 66 0 247 3 PLES_43501 Probable transcriptional regulatory protein PLES_43501 Pseudomonas aeruginosa (strain LESB58)
Q51423 5.01e-117 337 66 0 247 1 pmpR Transcriptional regulatory protein PmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VA08 9.56e-117 337 66 0 247 3 PSPA7_4544 Probable transcriptional regulatory protein PSPA7_4544 Pseudomonas aeruginosa (strain PA7)
A0Q6Q0 2.41e-114 330 63 0 243 3 FTN_1028 Probable transcriptional regulatory protein FTN_1028 Francisella tularensis subsp. novicida (strain U112)
Q5NH19 4.25e-114 330 62 0 243 3 FTT_0655 Probable transcriptional regulatory protein FTT_0655 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14IH1 4.25e-114 330 62 0 243 3 FTF0655 Probable transcriptional regulatory protein FTF0655 Francisella tularensis subsp. tularensis (strain FSC 198)
B2SH70 1.24e-113 328 62 0 243 3 FTM_1203 Probable transcriptional regulatory protein FTM_1203 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q48FC2 1.37e-113 328 65 0 247 3 PSPPH_3775 Probable transcriptional regulatory protein PSPPH_3775 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4IY88 1.55e-113 328 62 0 243 3 FTW_1073 Probable transcriptional regulatory protein FTW_1073 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q4ZWL4 4.01e-113 327 64 0 247 3 Psyr_1407 Probable transcriptional regulatory protein Psyr_1407 Pseudomonas syringae pv. syringae (strain B728a)
A7NBV2 4.14e-113 327 62 0 243 3 FTA_0979 Probable transcriptional regulatory protein FTA_0979 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q2A3R0 4.14e-113 327 62 0 243 3 FTL_0929 Probable transcriptional regulatory protein FTL_0929 Francisella tularensis subsp. holarctica (strain LVS)
Q0BM66 4.14e-113 327 62 0 243 3 FTH_0908 Probable transcriptional regulatory protein FTH_0908 Francisella tularensis subsp. holarctica (strain OSU18)
Q87Y32 8.07e-113 327 65 0 247 3 PSPTO_3980 Probable transcriptional regulatory protein PSPTO_3980 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0TZD8 8.25e-113 327 62 0 247 3 Fphi_1565 Probable transcriptional regulatory protein Fphi_1565 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q88NJ3 4.12e-112 325 65 0 243 3 PP_1214 Probable transcriptional regulatory protein PP_1214 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5QYV3 4.71e-112 325 64 0 247 3 IL1088 Probable transcriptional regulatory protein IL1088 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q4K7D6 2.24e-110 320 63 0 247 3 PFL_4766 Probable transcriptional regulatory protein PFL_4766 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q609L3 6.19e-110 319 61 0 247 3 MCA1220 Probable transcriptional regulatory protein MCA1220 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q2SCK9 1.19e-108 316 63 1 243 3 HCH_04926 Probable transcriptional regulatory protein HCH_04926 Hahella chejuensis (strain KCTC 2396)
B0VC84 4.57e-108 315 63 2 248 3 ABAYE2155 Probable transcriptional regulatory protein ABAYE2155 Acinetobacter baumannii (strain AYE)
B0VR58 4.57e-108 315 63 2 248 3 ABSDF2152 Probable transcriptional regulatory protein ABSDF2152 Acinetobacter baumannii (strain SDF)
B7H3U3 4.57e-108 315 63 2 248 3 ABBFA_001989 Probable transcriptional regulatory protein ABBFA_001989 Acinetobacter baumannii (strain AB307-0294)
B7I4G5 4.57e-108 315 63 2 248 3 AB57_1731 Probable transcriptional regulatory protein AB57_1731 Acinetobacter baumannii (strain AB0057)
B2HYW1 4.57e-108 315 63 2 248 3 ACICU_01536 Probable transcriptional regulatory protein ACICU_01536 Acinetobacter baumannii (strain ACICU)
A3M4T0 5.69e-108 314 63 2 248 3 A1S_1496 Probable transcriptional regulatory protein A1S_1496 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q6FAP5 1.12e-107 313 62 2 248 3 ACIAD2052 Probable transcriptional regulatory protein ACIAD2052 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4FT67 4.28e-106 310 62 2 248 3 Psyc_0938 Probable transcriptional regulatory protein Psyc_0938 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QAP5 3.1e-105 307 62 2 248 3 Pcryo_1479 Probable transcriptional regulatory protein Pcryo_1479 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0VRK0 9.17e-104 303 62 1 237 3 ABO_0750 Probable transcriptional regulatory protein ABO_0750 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B6IYU5 2.89e-102 300 59 0 243 3 CbuG_0446 Probable transcriptional regulatory protein CbuG_0446 Coxiella burnetii (strain CbuG_Q212)
A9KF43 2.89e-102 300 59 0 243 3 CBUD_0422 Probable transcriptional regulatory protein CBUD_0422 Coxiella burnetii (strain Dugway 5J108-111)
B6J503 2.89e-102 300 59 0 243 3 CbuK_1793 Probable transcriptional regulatory protein CbuK_1793 Coxiella burnetii (strain CbuK_Q154)
A9N9A0 2.89e-102 300 59 0 243 3 COXBURSA331_A1752 Probable transcriptional regulatory protein COXBURSA331_A1752 Coxiella burnetii (strain RSA 331 / Henzerling II)
Q83BE4 2.89e-102 300 59 0 243 1 CBU_1566 Probable transcriptional regulatory protein CBU_1566 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q3JES6 2.97e-102 300 57 0 247 3 Noc_0137 Probable transcriptional regulatory protein Noc_0137 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1QWG1 3.47e-102 300 60 1 248 3 Csal_1845 Probable transcriptional regulatory protein Csal_1845 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2Y5G2 6.28e-99 291 60 0 234 3 Nmul_A2722 Probable transcriptional regulatory protein Nmul_A2722 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A5WE72 1.41e-98 290 60 2 248 3 PsycPRwf_1013 Probable transcriptional regulatory protein PsycPRwf_1013 Psychrobacter sp. (strain PRwf-1)
Q82XP6 7.47e-97 286 59 0 234 3 NE0210 Probable transcriptional regulatory protein NE0210 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8GUJ7 3.48e-96 284 62 0 247 3 Tgr7_2237 Probable transcriptional regulatory protein Tgr7_2237 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0AJA6 3.82e-95 281 58 0 234 3 Neut_0281 Probable transcriptional regulatory protein Neut_0281 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9JYC7 8.97e-95 281 58 0 234 3 NMB1648 Probable transcriptional regulatory protein NMB1648 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5P3B7 1.8e-94 280 58 0 234 3 AZOSEA20720 Probable transcriptional regulatory protein AZOSEA20720 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9JTB0 3.48e-94 279 58 0 234 3 NMA1902 Probable transcriptional regulatory protein NMA1902 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KV56 3.48e-94 279 58 0 234 3 NMC1563 Probable transcriptional regulatory protein NMC1563 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
B3E787 8.55e-94 278 54 2 248 3 Glov_1245 Probable transcriptional regulatory protein Glov_1245 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B4RMZ8 1.59e-93 277 57 0 234 3 NGK_1508 Probable transcriptional regulatory protein NGK_1508 Neisseria gonorrhoeae (strain NCCP11945)
Q5F792 1.64e-93 277 57 0 234 3 NGO1291 Probable transcriptional regulatory protein NGO1291 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1AW54 8.67e-93 276 53 1 247 3 Rmag_0394 Probable transcriptional regulatory protein Rmag_0394 Ruthia magnifica subsp. Calyptogena magnifica
A4G2N0 1.16e-92 275 57 0 239 3 HEAR0561 Probable transcriptional regulatory protein HEAR0561 Herminiimonas arsenicoxydans
A9ITM2 2.26e-92 275 58 0 234 3 Bpet3099 Probable transcriptional regulatory protein Bpet3099 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B5EJL6 2.8e-92 275 56 2 248 3 Lferr_0060 Probable transcriptional regulatory protein Lferr_0060 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3G0 2.8e-92 275 56 2 248 3 AFE_0059 Probable transcriptional regulatory protein AFE_0059 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q5ZW02 9.8e-92 273 55 1 243 3 lpg1286 Probable transcriptional regulatory protein lpg1286 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A6SVD7 3.18e-91 271 56 0 239 3 mma_0544 Probable transcriptional regulatory protein mma_0544 Janthinobacterium sp. (strain Marseille)
Q5X5S1 7.48e-91 271 55 1 243 3 lpp1249 Probable transcriptional regulatory protein lpp1249 Legionella pneumophila (strain Paris)
A1K2Y6 1.09e-90 270 56 2 235 3 azo0574 Probable transcriptional regulatory protein azo0574 Azoarcus sp. (strain BH72)
A2S4B3 1.33e-90 270 59 0 242 3 BMA10229_A0792 Probable transcriptional regulatory protein BMA10229_A0792 Burkholderia mallei (strain NCTC 10229)
A1V2G2 1.33e-90 270 59 0 242 3 BMASAVP1_A1075 Probable transcriptional regulatory protein BMASAVP1_A1075 Burkholderia mallei (strain SAVP1)
A3MI47 1.33e-90 270 59 0 242 3 BMA10247_0358 Probable transcriptional regulatory protein BMA10247_0358 Burkholderia mallei (strain NCTC 10247)
Q62IJ0 1.33e-90 270 59 0 242 3 BMA1884 Probable transcriptional regulatory protein BMA1884 Burkholderia mallei (strain ATCC 23344)
Q3JUF8 1.33e-90 270 59 0 242 3 BURPS1710b_1385 Probable transcriptional regulatory protein BURPS1710b_1385 Burkholderia pseudomallei (strain 1710b)
A3NT48 1.33e-90 270 59 0 242 3 BURPS1106A_1240 Probable transcriptional regulatory protein BURPS1106A_1240 Burkholderia pseudomallei (strain 1106a)
A3N7F9 1.33e-90 270 59 0 242 3 BURPS668_1231 Probable transcriptional regulatory protein BURPS668_1231 Burkholderia pseudomallei (strain 668)
Q63VS9 1.33e-90 270 59 0 242 3 BPSL1165 Probable transcriptional regulatory protein BPSL1165 Burkholderia pseudomallei (strain K96243)
A5IBD9 1.5e-90 270 54 1 243 3 LPC_0711 Probable transcriptional regulatory protein LPC_0711 Legionella pneumophila (strain Corby)
A1WZ62 1.66e-90 270 54 0 242 3 Hhal_2210 Probable transcriptional regulatory protein Hhal_2210 Halorhodospira halophila (strain DSM 244 / SL1)
Q5WX49 5.89e-90 268 54 1 243 3 lpl1249 Probable transcriptional regulatory protein lpl1249 Legionella pneumophila (strain Lens)
A9AJK0 1e-89 268 58 0 242 3 Bmul_0984 Probable transcriptional regulatory protein Bmul_0984/BMULJ_02280 Burkholderia multivorans (strain ATCC 17616 / 249)
A4JGH5 1.06e-89 268 58 0 242 3 Bcep1808_2379 Probable transcriptional regulatory protein Bcep1808_2379 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q7W7T8 1.07e-89 268 56 0 236 3 BPP2422 Probable transcriptional regulatory protein BPP2422 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL78 1.07e-89 268 56 0 236 3 BB1871 Probable transcriptional regulatory protein BB1871 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1W753 2.17e-89 267 55 0 239 3 Ajs_1898 Probable transcriptional regulatory protein Ajs_1898 Acidovorax sp. (strain JS42)
Q7VWE9 2.68e-89 267 56 0 236 3 BP2308 Probable transcriptional regulatory protein BP2308 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B1YU49 2.77e-89 266 58 0 242 3 BamMC406_2210 Probable transcriptional regulatory protein BamMC406_2210 Burkholderia ambifaria (strain MC40-6)
A4SWH2 3.05e-89 266 55 0 236 3 Pnuc_0618 Probable transcriptional regulatory protein Pnuc_0618 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A5EXG2 3.09e-89 266 54 1 242 3 DNO_1179 Probable transcriptional regulatory protein DNO_1179 Dichelobacter nodosus (strain VCS1703A)
Q0BD85 5.16e-89 266 58 0 242 3 Bamb_2332 Probable transcriptional regulatory protein Bamb_2332 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q3SGS9 5.22e-89 266 54 1 243 3 Tbd_2215 Probable transcriptional regulatory protein Tbd_2215 Thiobacillus denitrificans (strain ATCC 25259)
C6E1T1 5.77e-89 266 52 1 242 3 GM21_0933 Probable transcriptional regulatory protein GM21_0933 Geobacter sp. (strain M21)
Q39XN9 9.33e-89 265 53 1 242 3 Gmet_0743 Probable transcriptional regulatory protein Gmet_0743 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A1ASF6 1.21e-88 265 52 2 248 3 Ppro_2673 Probable transcriptional regulatory protein Ppro_2673 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q2SZT0 1.44e-88 265 57 0 242 3 BTH_I1015 Probable transcriptional regulatory protein BTH_I1015 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B5EAH0 1.88e-88 265 52 1 242 3 Gbem_3313 Probable transcriptional regulatory protein Gbem_3313 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B4E5R6 2.69e-88 264 57 0 242 3 BceJ2315_23480 Probable transcriptional regulatory protein BceJ2315_23480 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1JW41 2.69e-88 264 57 0 242 3 Bcenmc03_2317 Probable transcriptional regulatory protein Bcenmc03_2317 Burkholderia orbicola (strain MC0-3)
A0K968 2.69e-88 264 57 0 242 3 Bcen2424_2294 Probable transcriptional regulatory protein Bcen2424_2294 Burkholderia cenocepacia (strain HI2424)
Q1BUW9 2.69e-88 264 57 0 242 3 Bcen_1682 Probable transcriptional regulatory protein Bcen_1682 Burkholderia orbicola (strain AU 1054)
Q2KYW0 3.06e-88 264 56 0 236 3 BAV2207 Probable transcriptional regulatory protein BAV2207 Bordetella avium (strain 197N)
A0L4W1 6.96e-88 263 52 3 249 3 Mmc1_0479 Probable transcriptional regulatory protein Mmc1_0479 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q39EA1 1.29e-87 262 57 0 242 3 Bcep18194_A5621 Probable transcriptional regulatory protein Bcep18194_A5621 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C0QGP3 1.31e-87 263 53 4 250 3 HRM2_04000 Probable transcriptional regulatory protein HRM2_04000 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A1TS27 1.52e-87 262 55 0 236 3 Aave_3203 Probable transcriptional regulatory protein Aave_3203 Paracidovorax citrulli (strain AAC00-1)
P62036 2.88e-87 262 52 1 242 3 GSU1074 Probable transcriptional regulatory protein GSU1074 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q3A233 4.26e-87 261 53 1 247 3 Pcar_2335 Probable transcriptional regulatory protein Pcar_2335 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5KWQ7 9.45e-87 260 53 2 243 3 GK2594 Probable transcriptional regulatory protein GK2594 Geobacillus kaustophilus (strain HTA426)
B9LZC7 1.16e-86 260 52 1 242 3 Geob_2326 Probable transcriptional regulatory protein Geob_2326 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
C1DAZ0 3.24e-86 259 57 0 234 3 LHK_02347 Probable transcriptional regulatory protein LHK_02347 Laribacter hongkongensis (strain HLHK9)
Q142L6 3.39e-86 259 57 0 242 3 Bxeno_A1185 Probable transcriptional regulatory protein Bxeno_A1185 Paraburkholderia xenovorans (strain LB400)
C0QT62 4.08e-86 259 52 2 245 3 PERMA_0079 Probable transcriptional regulatory protein PERMA_0079 Persephonella marina (strain DSM 14350 / EX-H1)
P62042 4.41e-86 259 54 2 242 3 TDE_1487 Probable transcriptional regulatory protein TDE_1487 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A5G9Y5 5.54e-86 258 51 1 242 3 Gura_1416 Probable transcriptional regulatory protein Gura_1416 Geotalea uraniireducens (strain Rf4)
B2T2A5 6.17e-86 258 57 0 242 3 Bphyt_1301 Probable transcriptional regulatory protein Bphyt_1301 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q46YA0 6.81e-86 258 56 0 241 3 Reut_A2522 Probable transcriptional regulatory protein Reut_A2522 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C5D5F1 7.2e-86 258 53 3 243 3 GWCH70_2524 Probable transcriptional regulatory protein GWCH70_2524 Geobacillus sp. (strain WCH70)
B3R3E4 8.47e-86 258 56 0 241 3 RALTA_A0859 Probable transcriptional regulatory protein RALTA_A0859 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B2U8Z2 1.34e-85 257 58 0 241 3 Rpic_2388 Probable transcriptional regulatory protein Rpic_2388 Ralstonia pickettii (strain 12J)
Q0KD59 4.8e-85 256 56 0 241 3 H16_A0916 Probable transcriptional regulatory protein H16_A0916 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A4IRB5 5.67e-85 256 51 2 243 3 GTNG_2524 Probable transcriptional regulatory protein GTNG_2524 Geobacillus thermodenitrificans (strain NG80-2)
Q478D8 6.96e-85 255 53 0 241 3 Daro_4067 Probable transcriptional regulatory protein Daro_4067 Dechloromonas aromatica (strain RCB)
B7GFM4 7.6e-85 255 51 2 243 3 Aflv_0709 Probable transcriptional regulatory protein Aflv_0709 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B4U7S7 1.03e-84 255 51 3 249 3 HY04AAS1_0501 Probable transcriptional regulatory protein HY04AAS1_0501 Hydrogenobaculum sp. (strain Y04AAS1)
Q7NTD5 5.13e-84 253 55 0 241 3 CV_3123 Probable transcriptional regulatory protein CV_3123 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8XXC5 7.44e-84 253 56 0 241 3 RSc2190 Probable transcriptional regulatory protein RSc2190 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2S369 1.07e-82 250 50 2 244 3 TPASS_0474 Probable transcriptional regulatory protein TPASS_0474 Treponema pallidum subsp. pallidum (strain SS14)
O83487 1.07e-82 250 50 2 244 3 TP_0474 Probable transcriptional regulatory protein TP_0474 Treponema pallidum (strain Nichols)
B2JE34 1.42e-82 249 56 0 242 3 Bphy_2064 Probable transcriptional regulatory protein Bphy_2064 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1LQA5 3.43e-82 249 54 0 241 3 Rmet_0785 Probable transcriptional regulatory protein Rmet_0785 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8RIE0 4.75e-82 248 52 3 249 3 FN1661 Probable transcriptional regulatory protein FN1661 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B0TF65 8.28e-82 248 51 3 251 3 Helmi_17570 Probable transcriptional regulatory protein Helmi_17570 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A5CX42 2.47e-81 246 47 1 243 3 COSY_0365 Probable transcriptional regulatory protein COSY_0365 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
O67517 4.85e-81 246 48 3 245 1 aq_1575 Probable transcriptional regulatory protein aq_1575 Aquifex aeolicus (strain VF5)
A8ZT17 5.13e-81 246 49 2 244 3 Dole_0371 Probable transcriptional regulatory protein Dole_0371 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q1GYR5 1.72e-80 244 54 0 241 3 Mfla_2355 Probable transcriptional regulatory protein Mfla_2355 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1B3A6 1.84e-80 244 52 3 248 3 Pden_1905 Probable transcriptional regulatory protein Pden_1905 Paracoccus denitrificans (strain Pd 1222)
Q891Z5 5.01e-80 243 50 2 244 3 CTC_02215 Probable transcriptional regulatory protein CTC_02215 Clostridium tetani (strain Massachusetts / E88)
B9MQH7 5.47e-80 243 49 2 244 3 Athe_0816 Probable transcriptional regulatory protein Athe_0816 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A9WWJ3 7.33e-80 243 50 3 248 3 BSUIS_B1192 Probable transcriptional regulatory protein BSUIS_B1192 Brucella suis (strain ATCC 23445 / NCTC 10510)
P67173 7.33e-80 243 50 3 248 3 BMEI0321 Probable transcriptional regulatory protein BMEI0321 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REX9 7.33e-80 243 50 3 248 3 BMEA_A1769 Probable transcriptional regulatory protein BMEA_A1769 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M7L4 7.33e-80 243 50 3 248 3 BCAN_A1755 Probable transcriptional regulatory protein BCAN_A1755 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YRF2 7.33e-80 243 50 3 248 3 BAB1_1729 Probable transcriptional regulatory protein BAB1_1729 Brucella abortus (strain 2308)
P67174 7.33e-80 243 50 3 248 3 BR1717 Probable transcriptional regulatory protein BR1717/BS1330_I1711 Brucella suis biovar 1 (strain 1330)
Q57BG3 7.33e-80 243 50 3 248 3 BruAb1_1702 Probable transcriptional regulatory protein BruAb1_1702 Brucella abortus biovar 1 (strain 9-941)
A5VS72 7.33e-80 243 50 3 248 3 BOV_1660 Probable transcriptional regulatory protein BOV_1660 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q12C45 7.84e-80 243 53 0 236 3 Bpro_1967 Probable transcriptional regulatory protein Bpro_1967 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q1GFE0 3.3e-79 241 50 3 248 3 TM1040_1893 Probable transcriptional regulatory protein TM1040_1893 Ruegeria sp. (strain TM1040)
A0PZU0 5.11e-79 241 49 2 245 3 NT01CX_1819 Probable transcriptional regulatory protein NT01CX_1819 Clostridium novyi (strain NT)
Q21WQ3 6.79e-79 240 52 0 242 3 Rfer_2075 Probable transcriptional regulatory protein Rfer_2075 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q65GN7 9.22e-79 240 48 2 239 3 BLi02909 Probable transcriptional regulatory protein BLi02909/BL01150 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B2FRN8 2.74e-78 239 56 1 228 3 Smlt3713 Probable transcriptional regulatory protein Smlt3713 Stenotrophomonas maltophilia (strain K279a)
C5C5Q3 4.92e-78 238 49 4 256 3 Bcav_1989 Probable transcriptional regulatory protein Bcav_1989 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q3BQF0 5.76e-78 238 54 1 234 3 XCV3282 Probable transcriptional regulatory protein XCV3282 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8P6E3 5.82e-78 238 56 1 227 3 XCC3027 Probable transcriptional regulatory protein XCC3027 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RPY2 5.82e-78 238 56 1 227 3 xcc-b100_1169 Probable transcriptional regulatory protein xcc-b100_1169 Xanthomonas campestris pv. campestris (strain B100)
Q4UXM2 5.82e-78 238 56 1 227 3 XC_1131 Probable transcriptional regulatory protein XC_1131 Xanthomonas campestris pv. campestris (strain 8004)
Q6FYQ2 6.07e-78 238 50 3 248 3 BQ11790 Probable transcriptional regulatory protein BQ11790 Bartonella quintana (strain Toulouse)
C4XIK1 7.08e-78 238 46 2 244 3 DMR_30850 Probable transcriptional regulatory protein DMR_30850 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B5YHS2 8.68e-78 238 46 2 244 3 THEYE_A1868 Probable transcriptional regulatory protein THEYE_A1868 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q5LUI2 8.8e-78 238 50 3 248 3 SPO1072 Probable transcriptional regulatory protein SPO1072 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q838A9 9.1e-78 237 50 2 237 3 EF_0663 Probable transcriptional regulatory protein EF_0663 Enterococcus faecalis (strain ATCC 700802 / V583)
B3QLZ4 1.04e-77 238 47 1 248 3 Cpar_0525 Probable transcriptional regulatory protein Cpar_0525 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B8DNJ5 1.21e-77 237 53 3 248 3 DvMF_3201 Probable transcriptional regulatory protein DvMF_3201 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q3ABX7 1.42e-77 237 45 3 246 3 CHY_1525 Probable transcriptional regulatory protein CHY_1525 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A0LGY9 2.17e-77 237 50 3 245 3 Sfum_0996 Probable transcriptional regulatory protein Sfum_0996 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B8CXG6 2.64e-77 236 48 3 247 3 Hore_12350 Probable transcriptional regulatory protein Hore_12350 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A4XI43 3.09e-77 236 49 2 238 3 Csac_0964 Probable transcriptional regulatory protein Csac_0964 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q2LRB1 3.91e-77 236 47 3 249 3 SYNAS_07390 Probable transcriptional regulatory protein SYNAS_07390 Syntrophus aciditrophicus (strain SB)
A2SFG0 5.75e-77 235 52 0 241 3 Mpe_A1337 Probable transcriptional regulatory protein Mpe_A1337 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B0S1S1 7.8e-77 235 50 3 240 3 FMG_0893 Probable transcriptional regulatory protein FMG_0893 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B2A5L8 8.66e-77 235 47 2 247 3 Nther_1800 Probable transcriptional regulatory protein Nther_1800 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B2V8P8 9.65e-77 235 47 2 249 3 SYO3AOP1_0685 Probable transcriptional regulatory protein SYO3AOP1_0685 Sulfurihydrogenibium sp. (strain YO3AOP1)
Q6AJ43 1.02e-76 235 48 3 249 3 DP2908 Probable transcriptional regulatory protein DP2908 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q47N40 1.04e-76 235 50 4 253 3 Tfu_2096 Probable transcriptional regulatory protein Tfu_2096 Thermobifida fusca (strain YX)
Q168H2 1.04e-76 235 50 3 248 3 RD1_2018 Probable transcriptional regulatory protein RD1_2018 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5H2A8 1.26e-76 234 53 1 234 3 XOO1659 Probable transcriptional regulatory protein XOO1659 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P579 1.26e-76 234 53 1 234 3 XOO1543 Probable transcriptional regulatory protein XOO1543 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A8LWZ6 1.35e-76 234 48 4 255 3 Sare_1779 Probable transcriptional regulatory protein Sare_1779 Salinispora arenicola (strain CNS-205)
A6LLP5 2.36e-76 234 48 4 248 3 Tmel_0985 Probable transcriptional regulatory protein Tmel_0985 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
A4FBA3 2.52e-76 234 50 3 245 3 SACE_2018 Probable transcriptional regulatory protein SACE_2018 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
B8FL13 2.52e-76 234 48 2 243 3 Dalk_2958 Probable transcriptional regulatory protein Dalk_2958 Desulfatibacillum aliphaticivorans
Q5YTE1 3.77e-76 234 50 4 255 3 NFA_37020 Probable transcriptional regulatory protein NFA_37020 Nocardia farcinica (strain IFM 10152)
A9IYI8 4.16e-76 233 50 3 248 3 BT_2363 Probable transcriptional regulatory protein BT_2363 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A1UR98 4.21e-76 233 49 3 248 3 BARBAKC583_0163 Probable transcriptional regulatory protein BARBAKC583_0163 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q92M88 5.65e-76 233 50 3 248 3 R02753 Probable transcriptional regulatory protein R02753 Rhizobium meliloti (strain 1021)
A4WQ19 6.1e-76 233 50 3 248 3 Rsph17025_0577 Probable transcriptional regulatory protein Rsph17025_0577 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B9KL75 8.93e-76 233 50 3 248 3 RSKD131_2012 Probable transcriptional regulatory protein RSKD131_2012 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A0LUK8 1.03e-75 232 50 3 247 3 Acel_1346 Probable transcriptional regulatory protein Acel_1346 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A4X5V5 1.06e-75 232 47 4 255 3 Strop_1792 Probable transcriptional regulatory protein Strop_1792 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8YUH0 1.07e-75 232 50 3 237 3 lhv_0777 Probable transcriptional regulatory protein lhv_0777 Lactobacillus helveticus (strain DPC 4571)
A1WQN6 1.31e-75 232 51 0 239 3 Veis_4238 Probable transcriptional regulatory protein Veis_4238 Verminephrobacter eiseniae (strain EF01-2)
A1T879 1.54e-75 232 50 3 249 3 Mvan_2570 Probable transcriptional regulatory protein Mvan_2570 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A6WY63 1.74e-75 232 48 3 248 3 Oant_1200 Probable transcriptional regulatory protein Oant_1200 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A0QWH1 1.91e-75 232 49 3 249 1 MSMEG_2940 Probable transcriptional regulatory protein MSMEG_2940/MSMEI_2866 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9ZNK0 2e-75 231 47 2 243 3 None Probable transcriptional regulatory protein ORF2U Hathewaya histolytica
Q7URR4 2.72e-75 231 47 0 242 3 RB5500 Probable transcriptional regulatory protein RB5500 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q28LW5 2.91e-75 231 50 4 254 3 Jann_3380 Probable transcriptional regulatory protein Jann_3380 Jannaschia sp. (strain CCS1)
Q3J055 2.96e-75 231 50 3 248 3 RHOS4_22610 Probable transcriptional regulatory protein RHOS4_22610 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P62035 3.16e-75 231 49 3 248 1 DVU_2259 Probable transcriptional regulatory protein DVU_2259 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q662Y7 3.53e-75 231 48 3 245 3 BG0025 Probable transcriptional regulatory protein BG0025 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q6G5P2 3.56e-75 231 49 3 248 3 BH14810 Probable transcriptional regulatory protein BH14810 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A1UF88 4.47e-75 231 49 3 249 3 Mkms_2298 Probable transcriptional regulatory protein Mkms_2298 Mycobacterium sp. (strain KMS)
A3PYU9 4.47e-75 231 49 3 249 3 Mjls_2290 Probable transcriptional regulatory protein Mjls_2290 Mycobacterium sp. (strain JLS)
Q1B9S5 4.47e-75 231 49 3 249 3 Mmcs_2251 Probable transcriptional regulatory protein Mmcs_2251 Mycobacterium sp. (strain MCS)
C3MIH9 4.53e-75 231 49 3 248 3 NGR_c27950 Probable transcriptional regulatory protein NGR_c27950 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A3PM44 4.99e-75 231 50 3 248 3 Rsph17029_2308 Probable transcriptional regulatory protein Rsph17029_2308 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B8J4I9 5.11e-75 231 49 4 245 3 Ddes_0536 Probable transcriptional regulatory protein Ddes_0536 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B0K0L3 5.7e-75 230 45 2 244 3 Teth514_1449 Probable transcriptional regulatory protein Teth514_1449 Thermoanaerobacter sp. (strain X514)
B0K951 5.7e-75 230 45 2 244 3 Teth39_1009 Probable transcriptional regulatory protein Teth39_1009 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C6C067 5.82e-75 230 47 3 246 3 Desal_2886 Probable transcriptional regulatory protein Desal_2886 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A7HM20 8.68e-75 230 48 4 250 3 Fnod_1106 Probable transcriptional regulatory protein Fnod_1106 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q9WYT7 9.26e-75 230 46 3 243 3 TM_0466 Probable transcriptional regulatory protein TM_0466 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1L927 1.01e-74 230 46 3 243 3 TRQ2_0469 Probable transcriptional regulatory protein TRQ2_0469 Thermotoga sp. (strain RQ2)
B1MCJ6 1.07e-74 230 49 4 253 3 MAB_2888c Probable transcriptional regulatory protein MAB_2888c Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A1VC41 1.26e-74 229 49 3 248 3 Dvul_0986 Probable transcriptional regulatory protein Dvul_0986 Nitratidesulfovibrio vulgaris (strain DP4)
A4TD17 1.48e-74 229 49 3 249 3 Mflv_3828 Probable transcriptional regulatory protein Mflv_3828 Mycolicibacterium gilvum (strain PYR-GCK)
Q11DG1 1.8e-74 229 49 3 248 3 Meso_3192 Probable transcriptional regulatory protein Meso_3192 Chelativorans sp. (strain BNC1)
Q827T9 1.82e-74 229 48 3 245 3 SAV_6832 Probable transcriptional regulatory protein SAV_6832 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B2KDV7 1.95e-74 229 46 3 245 3 Emin_1151 Probable transcriptional regulatory protein Emin_1151 Elusimicrobium minutum (strain Pei191)
B3EMM7 2.08e-74 229 46 1 244 3 Cphamn1_0542 Probable transcriptional regulatory protein Cphamn1_0542 Chlorobium phaeobacteroides (strain BS1)
Q38W22 2.13e-74 229 49 5 245 3 LCA_1307 Probable transcriptional regulatory protein LCA_1307 Latilactobacillus sakei subsp. sakei (strain 23K)
A6UCU1 2.22e-74 229 49 3 248 3 Smed_2641 Probable transcriptional regulatory protein Smed_2641 Sinorhizobium medicae (strain WSM419)
Q5FL22 2.35e-74 229 49 3 237 3 LBA0733 Probable transcriptional regulatory protein LBA0733 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q5FQC7 2.73e-74 229 48 2 248 3 GOX1679 Probable transcriptional regulatory protein GOX1679 Gluconobacter oxydans (strain 621H)
Q89U83 2.76e-74 229 48 3 248 3 blr1534 Probable transcriptional regulatory protein blr1534 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q0AX12 2.85e-74 229 47 4 252 3 Swol_1435 Probable transcriptional regulatory protein Swol_1435 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q042I3 3.06e-74 228 49 3 237 3 LGAS_1276 Probable transcriptional regulatory protein LGAS_1276 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B8I4L5 3.15e-74 229 48 3 239 3 Ccel_0181 Probable transcriptional regulatory protein Ccel_0181 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
P67178 4.12e-74 228 48 3 249 3 BQ2027_MB2635C Probable transcriptional regulatory protein Mb2635c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A5U5V4 4.12e-74 228 48 3 249 3 MRA_2631 Probable transcriptional regulatory protein MRA_2631 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KLV3 4.12e-74 228 48 3 249 3 BCG_2628c Probable transcriptional regulatory protein BCG_2628c Mycobacterium bovis (strain BCG / Pasteur 1173P2)
C1AF74 4.12e-74 228 48 3 249 3 JTY_2622 Probable transcriptional regulatory protein JTY_2622 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
P9WGA5 4.12e-74 228 48 3 249 1 Rv2603c Probable transcriptional regulatory protein Rv2603c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGA4 4.12e-74 228 48 3 249 3 MT2678 Probable transcriptional regulatory protein MT2678 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2GBA6 4.34e-74 228 48 4 255 3 Saro_0419 Probable transcriptional regulatory protein Saro_0419 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q88V33 5.05e-74 228 48 3 244 3 lp_2253 Probable transcriptional regulatory protein lp_2253 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A5IJV5 5.46e-74 228 46 3 243 3 Tpet_0454 Probable transcriptional regulatory protein Tpet_0454 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q8RAR7 5.94e-74 228 44 2 244 3 TTE1135 Probable transcriptional regulatory protein TTE1135 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2IS49 6.82e-74 228 48 3 248 3 RPB_4273 Probable transcriptional regulatory protein RPB_4273 Rhodopseudomonas palustris (strain HaA2)
Q03AF5 7.07e-74 228 47 3 245 3 LSEI_1022 Probable transcriptional regulatory protein LSEI_1022 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q1GAZ3 7.15e-74 228 48 3 237 3 Ldb0677 Probable transcriptional regulatory protein Ldb0677 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q04BD3 7.15e-74 228 48 3 237 3 LBUL_0609 Probable transcriptional regulatory protein LBUL_0609 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
B7J0W4 7.55e-74 228 47 3 245 3 BbuZS7_0025 Probable transcriptional regulatory protein BbuZS7_0025 Borreliella burgdorferi (strain ZS7)
O51056 7.55e-74 228 47 3 245 3 BB_0025 Probable transcriptional regulatory protein BB_0025 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P62037 8.51e-74 227 49 3 237 3 LJ_0904 Probable transcriptional regulatory protein LJ_0904 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q1GWB2 9.66e-74 227 51 4 245 3 Sala_0337 Probable transcriptional regulatory protein Sala_0337 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
P94447 1.11e-73 227 49 3 239 3 yrbC Probable transcriptional regulatory protein YrbC Bacillus subtilis (strain 168)
Q0SPD9 1.17e-73 227 48 3 245 3 BAPKO_0024 Probable transcriptional regulatory protein BAPKO_0024/BafPKo_0025 Borreliella afzelii (strain PKo)
B3PYY8 1.4e-73 227 49 3 248 3 RHECIAT_CH0003714 Probable transcriptional regulatory protein RHECIAT_CH0003714 Rhizobium etli (strain CIAT 652)
A5D3F8 1.4e-73 227 47 2 244 3 PTH_1024 Probable transcriptional regulatory protein PTH_1024 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q1IPS4 1.58e-73 227 50 5 246 3 Acid345_2125 Probable transcriptional regulatory protein Acid345_2125 Koribacter versatilis (strain Ellin345)
A0QIC5 1.78e-73 227 47 3 249 3 MAV_3481 Probable transcriptional regulatory protein MAV_3481 Mycobacterium avium (strain 104)
Q2K4K5 1.86e-73 227 49 4 249 3 RHE_CH03475 Probable transcriptional regulatory protein RHE_CH03475 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B7IHX7 2.04e-73 227 46 3 244 3 THA_1246 Probable transcriptional regulatory protein THA_1246 Thermosipho africanus (strain TCF52B)
B3WD20 2.1e-73 226 46 3 245 3 LCABL_11860 Probable transcriptional regulatory protein LCABL_11860 Lacticaseibacillus casei (strain BL23)
B2V2S0 2.14e-73 226 47 1 242 3 CLH_0943 Probable transcriptional regulatory protein CLH_0943 Clostridium botulinum (strain Alaska E43 / Type E3)
B2TML4 2.14e-73 226 47 1 242 3 CLL_A1008 Probable transcriptional regulatory protein CLL_A1008 Clostridium botulinum (strain Eklund 17B / Type B)
C1F121 2.17e-73 226 48 5 253 3 ACP_0521 Probable transcriptional regulatory protein ACP_0521 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B4ST36 2.37e-73 226 52 1 235 3 Smal_3128 Probable transcriptional regulatory protein Smal_3128 Stenotrophomonas maltophilia (strain R551-3)
A9WSE7 2.41e-73 226 46 3 249 3 RSal33209_2002 Probable transcriptional regulatory protein RSal33209_2002 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q98F44 2.44e-73 226 48 3 248 3 mll3945 Probable transcriptional regulatory protein mll3945 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q97GS1 2.85e-73 226 46 2 243 3 CA_C2295 Probable transcriptional regulatory protein CA_C2295 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B3EG35 2.93e-73 226 46 1 243 3 Clim_0475 Probable transcriptional regulatory protein Clim_0475 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q07H94 3.27e-73 226 47 3 248 3 RPE_4771 Probable transcriptional regulatory protein RPE_4771 Rhodopseudomonas palustris (strain BisA53)
B2GB45 3.35e-73 226 49 5 246 3 LAF_0541 Probable transcriptional regulatory protein LAF_0541 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C5CGU7 3.56e-73 226 46 4 250 3 Kole_1935 Probable transcriptional regulatory protein Kole_1935 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A1BDW8 4.58e-73 226 45 1 243 3 Cpha266_0538 Probable transcriptional regulatory protein Cpha266_0538 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A4QEN6 5.05e-73 226 49 4 250 3 cgR_1708 Probable transcriptional regulatory protein cgR_1708 Corynebacterium glutamicum (strain R)
B5ZP73 6.29e-73 225 48 3 248 3 Rleg2_3214 Probable transcriptional regulatory protein Rleg2_3214 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q92BH9 6.9e-73 225 47 3 243 3 lin1570 Probable transcriptional regulatory protein lin1570 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1MC59 7.49e-73 225 48 3 248 3 RL3983 Probable transcriptional regulatory protein RL3983 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8U9K1 9.62e-73 225 47 3 248 3 Atu3727 Probable transcriptional regulatory protein Atu3727 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2JD97 1.04e-72 225 47 4 256 3 Francci3_1368 Probable transcriptional regulatory protein Francci3_1368 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q0RNU9 1.13e-72 225 48 3 250 3 FRAAL2138 Probable transcriptional regulatory protein FRAAL2138 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A3DH53 1.26e-72 224 48 3 239 3 Cthe_2075 Probable transcriptional regulatory protein Cthe_2075 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2J7Y8 1.27e-72 224 47 2 249 3 Npun_R5651 Probable transcriptional regulatory protein Npun_R5651 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q20X07 1.38e-72 224 46 3 248 3 RPC_4807 Probable transcriptional regulatory protein RPC_4807 Rhodopseudomonas palustris (strain BisB18)
B4R9L7 1.66e-72 224 48 3 243 3 PHZ_c3068 Probable transcriptional regulatory protein PHZ_c3068 Phenylobacterium zucineum (strain HLK1)
Q3AU82 1.99e-72 224 45 1 242 3 Cag_0165 Probable transcriptional regulatory protein Cag_0165 Chlorobium chlorochromatii (strain CaD3)
Q8KBW7 2.03e-72 224 48 1 248 3 CT1665 Probable transcriptional regulatory protein CT1665 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8NPZ8 2.12e-72 224 49 4 250 3 Cgl1663 Probable transcriptional regulatory protein Cgl1663/cg1872 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q3SP09 2.13e-72 224 46 3 248 3 Nwi_2729 Probable transcriptional regulatory protein Nwi_2729 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q130U9 2.32e-72 224 47 3 248 3 RPD_4171 Probable transcriptional regulatory protein RPD_4171 Rhodopseudomonas palustris (strain BisB5)
B7K8I7 3.85e-72 223 45 4 253 3 PCC7424_2775 Probable transcriptional regulatory protein PCC7424_2775 Gloeothece citriformis (strain PCC 7424)
Q9L288 4.09e-72 223 47 4 251 3 SCO1521 Probable transcriptional regulatory protein SCO1521 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C1FKG4 4.57e-72 223 49 2 243 3 CLM_3478 Probable transcriptional regulatory protein CLM_3478 Clostridium botulinum (strain Kyoto / Type A2)
A7FY22 4.99e-72 223 49 2 243 3 CLB_3102 Probable transcriptional regulatory protein CLB_3102 Clostridium botulinum (strain ATCC 19397 / Type A)
A5I6F4 4.99e-72 223 49 2 243 3 CBO3073 Probable transcriptional regulatory protein CBO3073/CLC_2975 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
P62039 6.6e-72 223 46 3 249 3 MAP_1030 Probable transcriptional regulatory protein MAP_1030 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
B4SDW5 6.67e-72 223 45 1 248 3 Ppha_0657 Probable transcriptional regulatory protein Ppha_0657 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B9JRY6 9.06e-72 222 47 3 248 3 Avi_3631 Probable transcriptional regulatory protein Avi_3631 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B1W3G1 9.14e-72 223 48 3 245 3 SGR_6014 Probable transcriptional regulatory protein SGR_6014 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B8E2P4 9.35e-72 222 47 2 249 3 Dtur_1615 Probable transcriptional regulatory protein Dtur_1615 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q3MDT4 9.85e-72 222 46 2 249 3 Ava_1228 Probable transcriptional regulatory protein Ava_1228 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YPC2 1.38e-71 222 46 2 249 3 all4276 Probable transcriptional regulatory protein all4276 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B9L8T4 1.84e-71 221 45 2 237 3 NAMH_0626 Probable transcriptional regulatory protein NAMH_0626 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B0JTZ2 1.85e-71 222 47 4 253 3 MAE_13580 Probable transcriptional regulatory protein MAE_13580 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q03EU1 1.99e-71 221 49 4 237 3 PEPE_1240 Probable transcriptional regulatory protein PEPE_1240 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A6Q2G5 2.16e-71 221 50 1 236 3 NIS_0560 Probable transcriptional regulatory protein NIS_0560 Nitratiruptor sp. (strain SB155-2)
A6WCI2 2.65e-71 221 47 3 251 3 Krad_3057 Probable transcriptional regulatory protein Krad_3057 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B5RQK7 3.25e-71 221 45 5 248 3 BRE_29 Probable transcriptional regulatory protein BRE_29 Borrelia recurrentis (strain A1)
B5RLN2 3.36e-71 221 45 5 248 3 BDU_30 Probable transcriptional regulatory protein BDU_30 Borrelia duttonii (strain Ly)
Q0S1C9 3.56e-71 221 48 3 249 3 RHA1_ro06891 Probable transcriptional regulatory protein RHA1_ro06891 Rhodococcus jostii (strain RHA1)
Q6AFB7 3.67e-71 221 48 3 250 3 Lxx10750 Probable transcriptional regulatory protein Lxx10750 Leifsonia xyli subsp. xyli (strain CTCB07)
B1IMF6 3.95e-71 221 48 2 243 3 CLD_1467 Probable transcriptional regulatory protein CLD_1467 Clostridium botulinum (strain Okra / Type B1)
A4J533 3.96e-71 221 46 2 239 3 Dred_1658 Probable transcriptional regulatory protein Dred_1658 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C3KTD5 4.17e-71 221 48 2 243 3 CLJ_B3338 Probable transcriptional regulatory protein CLJ_B3338 Clostridium botulinum (strain 657 / Type Ba4)
A7GHU1 4.17e-71 221 48 2 243 3 CLI_3132 Probable transcriptional regulatory protein CLI_3132 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A1QYH8 4.22e-71 221 46 6 248 3 BT0025 Probable transcriptional regulatory protein BT0025 Borrelia turicatae (strain 91E135)
B1L0B5 5.13e-71 220 48 2 243 3 CLK_2466 Probable transcriptional regulatory protein CLK_2466 Clostridium botulinum (strain Loch Maree / Type A3)
Q8FPK2 5.21e-71 221 49 3 249 3 CE1776 Probable transcriptional regulatory protein CE1776 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1R727 6.14e-71 220 46 4 255 3 AAur_2300 Probable transcriptional regulatory protein AAur_2300 Paenarthrobacter aurescens (strain TC1)
Q0BT57 6.56e-71 220 46 2 248 3 GbCGDNIH1_1097 Probable transcriptional regulatory protein GbCGDNIH1_1097 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
C4LIY0 6.78e-71 220 48 3 249 3 ckrop_1032 Probable transcriptional regulatory protein ckrop_1032 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A0PSY4 6.99e-71 220 47 3 249 3 MUL_3246 Probable transcriptional regulatory protein MUL_3246 Mycobacterium ulcerans (strain Agy99)
B2HN50 6.99e-71 220 47 3 249 3 MMAR_2098 Probable transcriptional regulatory protein MMAR_2098 Mycobacterium marinum (strain ATCC BAA-535 / M)
B2S1L3 7.78e-71 220 45 5 247 3 BH0025 Probable transcriptional regulatory protein BH0025 Borrelia hermsii (strain HS1 / DAH)
Q8Y6Z5 7.96e-71 219 45 3 243 3 lmo1535 Probable transcriptional regulatory protein lmo1535 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1AWE6 9.09e-71 220 53 3 247 3 Rxyl_1318 Probable transcriptional regulatory protein Rxyl_1318 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A8KZE9 1.26e-70 219 46 4 256 3 Franean1_5147 Probable transcriptional regulatory protein Franean1_5147 Parafrankia sp. (strain EAN1pec)
C1B4C8 1.27e-70 219 48 4 253 3 ROP_68700 Probable transcriptional regulatory protein ROP_68700 Rhodococcus opacus (strain B4)
A8LJ00 1.31e-70 219 50 3 248 3 Dshi_2762 Probable transcriptional regulatory protein Dshi_2762 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q5NR77 1.33e-70 219 47 3 248 3 ZMO0153 Probable transcriptional regulatory protein ZMO0153 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C3PGR0 1.39e-70 219 48 4 250 3 cauri_1421 Probable transcriptional regulatory protein cauri_1421 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
C0ZZ45 1.42e-70 219 47 4 253 3 RER_29220 Probable transcriptional regulatory protein RER_29220 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q1WUV3 1.51e-70 219 46 4 245 3 LSL_0422 Probable transcriptional regulatory protein LSL_0422 Ligilactobacillus salivarius (strain UCC118)
Q8EPQ4 1.56e-70 219 47 3 239 3 OB2038 Probable transcriptional regulatory protein OB2038 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A9BHC2 2.61e-70 219 48 3 245 3 Pmob_0807 Probable transcriptional regulatory protein Pmob_0807 Petrotoga mobilis (strain DSM 10674 / SJ95)
Q71ZD5 2.64e-70 218 45 3 243 3 LMOf2365_1554 Probable transcriptional regulatory protein LMOf2365_1554 Listeria monocytogenes serotype 4b (strain F2365)
Q2JLT1 3.08e-70 218 46 3 245 3 CYB_1350 Probable transcriptional regulatory protein CYB_1350 Synechococcus sp. (strain JA-2-3B'a(2-13))
A0JXB4 7.26e-70 218 46 4 250 3 Arth_2304 Probable transcriptional regulatory protein Arth_2304 Arthrobacter sp. (strain FB24)
Q6A8L0 7.94e-70 218 45 4 262 3 PPA1157 Probable transcriptional regulatory protein PPA1157 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B5Y8Y9 8.03e-70 217 44 3 249 3 COPRO5265_0905 Probable transcriptional regulatory protein COPRO5265_0905 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q30YX4 8.96e-70 217 45 4 252 3 Dde_2325 Probable transcriptional regulatory protein Dde_2325 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B2I4S7 1.03e-69 217 52 2 228 3 XfasM23_0940 Probable transcriptional regulatory protein XfasM23_0940 Xylella fastidiosa (strain M23)
Q87D04 1.03e-69 217 52 2 228 3 PD_0885 Probable transcriptional regulatory protein PD_0885 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q2JSH9 1.29e-69 217 46 3 243 3 CYA_2259 Probable transcriptional regulatory protein CYA_2259 Synechococcus sp. (strain JA-3-3Ab)
B3QHR9 1.31e-69 217 49 3 248 3 Rpal_1287 Probable transcriptional regulatory protein Rpal_1287 Rhodopseudomonas palustris (strain TIE-1)
P62040 1.31e-69 217 49 3 248 3 RPA1097 Probable transcriptional regulatory protein RPA1097 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B2STK4 2.08e-69 216 55 1 227 3 PXO_01555 Probable transcriptional regulatory protein PXO_01555 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q9PC75 2.22e-69 216 51 2 228 3 XF_1906 Probable transcriptional regulatory protein XF_1906 Xylella fastidiosa (strain 9a5c)
B8FQV9 2.22e-69 216 47 3 247 3 Dhaf_3629 Probable transcriptional regulatory protein Dhaf_3629 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q24UN3 2.22e-69 216 47 3 247 3 DSY2470 Probable transcriptional regulatory protein DSY2470 Desulfitobacterium hafniense (strain Y51)
Q1MRQ1 2.44e-69 216 46 4 245 3 LI0269 Probable transcriptional regulatory protein LI0269 Lawsonia intracellularis (strain PHE/MN1-00)
Q4JVD6 2.56e-69 216 47 3 249 3 jk1057 Probable transcriptional regulatory protein jk1057 Corynebacterium jeikeium (strain K411)
Q3B2D4 2.96e-69 216 44 5 248 3 Plut_1643 Probable transcriptional regulatory protein Plut_1643 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q67QQ4 3.08e-69 216 47 2 239 3 STH1004 Probable transcriptional regulatory protein STH1004 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8PHU8 3.26e-69 216 54 1 227 3 XAC3151 Probable transcriptional regulatory protein XAC3151 Xanthomonas axonopodis pv. citri (strain 306)
A8MHN6 5.27e-69 215 49 3 237 3 Clos_1778 Probable transcriptional regulatory protein Clos_1778 Alkaliphilus oremlandii (strain OhILAs)
Q1QHP3 5.57e-69 215 45 5 250 3 Nham_3525 Probable transcriptional regulatory protein Nham_3525 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4SG34 5.87e-69 215 44 1 242 3 Cvib_1432 Probable transcriptional regulatory protein Cvib_1432 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q49645 6.9e-69 215 46 3 249 3 ML0475 Probable transcriptional regulatory protein ML0475 Mycobacterium leprae (strain TN)
B8ZUH9 6.9e-69 215 46 3 249 3 MLBr00475 Probable transcriptional regulatory protein MLBr00475 Mycobacterium leprae (strain Br4923)
A8F5Z3 8.55e-69 215 44 5 252 3 Tlet_1011 Probable transcriptional regulatory protein Tlet_1011 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B8H9D9 1.11e-68 214 46 4 250 3 Achl_2034 Probable transcriptional regulatory protein Achl_2034 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
B3ES20 1.59e-68 214 47 3 239 3 Aasi_0624 Probable transcriptional regulatory protein Aasi_0624 Amoebophilus asiaticus (strain 5a2)
B1H0B3 1.78e-68 214 45 3 246 3 TGRD_462 Probable transcriptional regulatory protein TGRD_462 Endomicrobium trichonymphae
B0U2D9 1.81e-68 214 51 2 228 3 Xfasm12_1059 Probable transcriptional regulatory protein Xfasm12_1059 Xylella fastidiosa (strain M12)
B5YFL4 3.31e-68 213 45 2 249 3 DICTH_1505 Probable transcriptional regulatory protein DICTH_1505 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B4S5F5 4.44e-68 213 46 1 243 3 Paes_0496 Probable transcriptional regulatory protein Paes_0496 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A5ERK3 5.3e-68 213 47 3 248 3 BBta_6910 Probable transcriptional regulatory protein BBta_6910 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B8EIB7 7.03e-68 213 45 3 248 3 Msil_2305 Probable transcriptional regulatory protein Msil_2305 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A8GVY2 8.82e-68 213 43 3 249 3 A1I_03240 Probable transcriptional regulatory protein A1I_03240 Rickettsia bellii (strain OSU 85-389)
Q2RHT3 1.22e-67 212 50 3 242 3 Moth_1704 Probable transcriptional regulatory protein Moth_1704 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q03R67 1.94e-67 211 47 3 237 3 LVIS_1199 Probable transcriptional regulatory protein LVIS_1199 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A7NH92 2.8e-67 211 47 4 250 3 Rcas_0718 Probable transcriptional regulatory protein Rcas_0718 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q1RJ15 3.03e-67 211 43 3 249 3 RBE_0568 Probable transcriptional regulatory protein RBE_0568 Rickettsia bellii (strain RML369-C)
A5V1E4 3.33e-67 211 47 4 250 3 RoseRS_4362 Probable transcriptional regulatory protein RoseRS_4362 Roseiflexus sp. (strain RS-1)
Q0ALW8 3.72e-67 211 45 3 253 3 Mmar10_2433 Probable transcriptional regulatory protein Mmar10_2433 Maricaulis maris (strain MCS10)
Q3Z9B1 4.07e-67 211 47 2 244 3 DET0444 Probable transcriptional regulatory protein DET0444 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A4YMC4 4.71e-67 210 47 3 248 3 BRADO1143 Probable transcriptional regulatory protein BRADO1143 Bradyrhizobium sp. (strain ORS 278)
B7JYY6 5.79e-67 210 44 4 250 3 PCC8801_2028 Probable transcriptional regulatory protein PCC8801_2028 Rippkaea orientalis (strain PCC 8801 / RF-1)
B6INM1 8.64e-67 210 49 3 245 3 RC1_1808 Probable transcriptional regulatory protein RC1_1808 Rhodospirillum centenum (strain ATCC 51521 / SW)
P62034 1.06e-66 209 45 3 249 3 DIP1378 Probable transcriptional regulatory protein DIP1378 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q3ZZK4 1.13e-66 209 46 2 244 3 cbdbA400 Probable transcriptional regulatory protein cbdbA400 Dehalococcoides mccartyi (strain CBDB1)
Q01TY1 1.66e-66 209 44 6 255 3 Acid_5948 Probable transcriptional regulatory protein Acid_5948 Solibacter usitatus (strain Ellin6076)
A9B4U5 1.71e-66 209 46 2 246 3 Haur_3030 Probable transcriptional regulatory protein Haur_3030 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q1IW96 1.77e-66 209 46 4 247 3 Dgeo_2194 Probable transcriptional regulatory protein Dgeo_2194 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
C4Z5P5 1.96e-66 209 48 5 242 3 EUBELI_00902 Probable transcriptional regulatory protein EUBELI_00902 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
B6JJ00 3.19e-66 208 47 3 248 3 OCAR_7305 Probable transcriptional regulatory protein OCAR_7305/OCA5_c08120 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q2RVF8 4.28e-66 208 46 2 244 3 Rru_A1086 Probable transcriptional regulatory protein Rru_A1086 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B3E045 4.93e-66 208 44 3 245 3 Minf_0651 Probable transcriptional regulatory protein Minf_0651 Methylacidiphilum infernorum (isolate V4)
Q6KI99 6.73e-66 207 45 6 246 3 MMOB1910 Probable transcriptional regulatory protein MMOB1910 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B1XP37 7.2e-66 207 43 3 250 3 SYNPCC7002_A1640 Probable transcriptional regulatory protein SYNPCC7002_A1640 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
C0R1L5 9.59e-66 207 43 3 245 3 BHWA1_01533 Probable transcriptional regulatory protein BHWA1_01533 Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A5FS26 1.12e-65 207 45 2 244 3 DehaBAV1_0421 Probable transcriptional regulatory protein DehaBAV1_0421 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B3QTP5 1.16e-65 207 49 1 242 3 Ctha_1786 Probable transcriptional regulatory protein Ctha_1786 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q189Y9 1.23e-65 206 48 3 237 3 CD630_07950 Probable transcriptional regulatory protein CD630_07950 Clostridioides difficile (strain 630)
B1VDJ5 2.18e-65 206 46 4 255 3 cu0933 Probable transcriptional regulatory protein cu0933 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
B1LUU4 2.81e-65 206 48 5 250 3 Mrad2831_3553 Probable transcriptional regulatory protein Mrad2831_3553 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A6M152 8.1e-65 204 47 2 242 3 Cbei_4222 Probable transcriptional regulatory protein Cbei_4222 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A7HUZ5 1.55e-64 204 42 3 244 3 Plav_2114 Probable transcriptional regulatory protein Plav_2114 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B8G4I7 1.68e-64 204 44 3 247 3 Cagg_2594 Probable transcriptional regulatory protein Cagg_2594 Chloroflexus aggregans (strain MD-66 / DSM 9485)
B1WS51 1.81e-64 204 42 3 252 3 cce_0894 Probable transcriptional regulatory protein cce_0894 Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q0TP06 1.83e-64 204 49 2 242 3 CPF_2210 Probable transcriptional regulatory protein CPF_2210 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q9XDU4 1.83e-64 204 49 2 242 3 CPE1954 Probable transcriptional regulatory protein CPE1954 Clostridium perfringens (strain 13 / Type A)
Q0SRM5 1.83e-64 204 49 2 242 3 CPR_1922 Probable transcriptional regulatory protein CPR_1922 Clostridium perfringens (strain SM101 / Type A)
B7L273 1.92e-64 204 47 5 244 3 Mchl_0946 Probable transcriptional regulatory protein Mchl_0946 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q04FS7 2.29e-64 203 46 4 244 3 OEOE_0768 Probable transcriptional regulatory protein OEOE_0768 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B9L0R1 2.66e-64 203 45 3 245 3 trd_1132 Probable transcriptional regulatory protein trd_1132 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
C4ZBH1 3.57e-64 203 49 3 240 3 EUBREC_1961 Probable transcriptional regulatory protein EUBREC_1961 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q1D2J3 4.34e-64 203 44 0 241 3 MXAN_4974 Probable transcriptional regulatory protein MXAN_4974 Myxococcus xanthus (strain DK1622)
B0UD14 5.23e-64 202 46 3 248 3 M446_6579 Probable transcriptional regulatory protein M446_6579 Methylobacterium sp. (strain 4-46)
B7GR15 6.67e-64 202 48 3 249 3 Blon_1155 Probable transcriptional regulatory protein Blon_1155/BLIJ_1182 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
A8GSK9 9.31e-64 202 43 5 251 3 A1G_04400 Probable transcriptional regulatory protein A1G_04400 Rickettsia rickettsii (strain Sheila Smith)
B8IN22 1.26e-63 201 46 3 248 3 Mnod_7401 Probable transcriptional regulatory protein Mnod_7401 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q92HU0 1.45e-63 202 42 4 250 3 RC0681 Probable transcriptional regulatory protein RC0681 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PNU7 2.32e-63 201 43 5 251 3 RAF_ORF0717 Probable transcriptional regulatory protein RAF_ORF0717 Rickettsia africae (strain ESF-5)
Q8G6C0 2.57e-63 201 49 4 250 3 BL0726 Probable transcriptional regulatory protein BL0726 Bifidobacterium longum (strain NCC 2705)
B3DRX7 2.57e-63 201 49 4 250 3 BLD_0450 Probable transcriptional regulatory protein BLD_0450 Bifidobacterium longum (strain DJO10A)
B9LAL6 3.32e-63 201 44 3 249 3 Chy400_1141 Probable transcriptional regulatory protein Chy400_1141 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WIH5 3.32e-63 201 44 3 249 3 Caur_1043 Probable transcriptional regulatory protein Caur_1043 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B2GIM1 4.59e-63 200 46 3 250 3 KRH_13670 Probable transcriptional regulatory protein KRH_13670 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q7NHM8 7.36e-63 200 41 2 245 3 glr2507 Probable transcriptional regulatory protein glr2507 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B0REB7 2.21e-62 199 43 4 251 3 CMS0715 Probable transcriptional regulatory protein CMS0715 Clavibacter sepedonicus
A1SJA3 2.21e-62 199 42 4 254 3 Noca_2383 Probable transcriptional regulatory protein Noca_2383 Nocardioides sp. (strain ATCC BAA-499 / JS614)
B0CDE2 2.53e-62 198 43 3 253 3 AM1_1847 Probable transcriptional regulatory protein AM1_1847 Acaryochloris marina (strain MBIC 11017)
B0SJP0 2.7e-62 198 44 3 245 3 LEPBI_I0056 Probable transcriptional regulatory protein LEPBI_I0056 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S959 2.7e-62 198 44 3 245 3 LBF_0056 Probable transcriptional regulatory protein LBF_0056 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A5VIZ6 3.39e-62 198 47 4 245 3 Lreu_0552 Probable transcriptional regulatory protein Lreu_0552 Limosilactobacillus reuteri (strain DSM 20016)
B2G6H2 3.39e-62 198 47 4 245 3 LAR_0538 Probable transcriptional regulatory protein LAR_0538 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A8IM90 3.73e-62 198 46 3 248 3 AZC_0510 Probable transcriptional regulatory protein AZC_0510 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A8EYL6 9.83e-62 197 41 4 250 3 A1E_02520 Probable transcriptional regulatory protein A1E_02520 Rickettsia canadensis (strain McKiel)
Q2GGC4 1.02e-61 197 43 4 241 3 ECH_0704 Probable transcriptional regulatory protein ECH_0704 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A9KMB4 1.11e-61 196 46 3 242 3 Cphy_2507 Probable transcriptional regulatory protein Cphy_2507 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A5CS09 1.24e-61 197 43 5 253 3 CMM_1817 Probable transcriptional regulatory protein CMM_1817 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
P62043 1.73e-61 196 45 4 247 3 WD_0484 Probable transcriptional regulatory protein WD_0484 Wolbachia pipientis wMel
Q9Z7Y0 1.82e-61 196 43 2 237 3 CPn_0573 Probable transcriptional regulatory protein CPn_0573/CP_0176/CPj0573/CpB0595 Chlamydia pneumoniae
C0R5P2 2.43e-61 196 44 4 247 3 WRi_002620 Probable transcriptional regulatory protein WRi_002620 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B1Z942 2.81e-61 196 47 3 242 3 Mpop_0922 Probable transcriptional regulatory protein Mpop_0922 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
C5CCI4 3.1e-61 196 46 4 255 3 Mlut_12910 Probable transcriptional regulatory protein Mlut_12910 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q5SK31 3.72e-61 195 44 4 240 3 TTHA0821 Probable transcriptional regulatory protein TTHA0821 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P62041 3.72e-61 195 44 4 240 3 TT_C0469 Probable transcriptional regulatory protein TT_C0469 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
C1A617 4.03e-61 195 44 3 247 3 GAU_0635 Probable transcriptional regulatory protein GAU_0635 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q5HBG4 5.38e-61 195 43 5 239 3 Erum3660 Probable transcriptional regulatory protein Erum3660/ERWE_CDS_03770 Ehrlichia ruminantium (strain Welgevonden)
Q5FHN8 5.38e-61 195 43 5 239 3 ERGA_CDS_03720 Probable transcriptional regulatory protein ERGA_CDS_03720 Ehrlichia ruminantium (strain Gardel)
C4K280 6.48e-61 195 41 5 251 3 RPR_05505 Probable transcriptional regulatory protein RPR_05505 Rickettsia peacockii (strain Rustic)
Q4ULC3 8.07e-61 194 42 7 252 3 RF_0799 Probable transcriptional regulatory protein RF_0799 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8DME3 9.97e-61 194 42 3 243 3 tll0175 Probable transcriptional regulatory protein tll0175 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3YSB1 1.17e-60 194 42 4 241 3 Ecaj_0351 Probable transcriptional regulatory protein Ecaj_0351 Ehrlichia canis (strain Jake)
Q8F839 1.76e-60 194 42 5 245 3 LA_0720 Probable transcriptional regulatory protein LA_0720 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62038 1.76e-60 194 42 5 245 3 LIC_12886 Probable transcriptional regulatory protein LIC_12886 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B8DUF0 3.78e-60 193 48 4 250 3 BLA_1344 Probable transcriptional regulatory protein BLA_1344 Bifidobacterium animalis subsp. lactis (strain AD011)
B0B830 1.98e-59 191 42 3 238 3 CTL0717 Probable transcriptional regulatory protein CTL0717 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B0BC95 1.98e-59 191 42 3 238 3 CTLon_0713 Probable transcriptional regulatory protein CTLon_0713 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KLP1 1.98e-59 191 42 3 238 3 CTA_0499 Probable transcriptional regulatory protein CTA_0499 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B8HYK3 3.01e-59 191 42 3 248 3 Cyan7425_4347 Probable transcriptional regulatory protein Cyan7425_4347 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A5V885 3.23e-59 190 46 4 250 3 Swit_2142 Probable transcriptional regulatory protein Swit_2142 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B2IDE7 3.56e-59 190 42 3 248 3 Bind_0345 Probable transcriptional regulatory protein Bind_0345 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A8GNY3 6.82e-59 189 42 6 251 3 A1C_04175 Probable transcriptional regulatory protein A1C_04175 Rickettsia akari (strain Hartford)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01135
Feature type CDS
Gene tACO1
Product YebC/PmpR family DNA-binding transcriptional regulator
Location 204843 - 205586 (strand: 1)
Length 744 (nucleotides) / 247 (amino acids)
In genomic island -

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_706
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01709 TACO1/YebC second and third domain
PF20772 TACO1/YebC protein N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0217 Transcription (K)
Translation, ribosomal structure and biogenesis (J)
KJ Transcriptional and/or translational regulatory protein YebC/TACO1

Protein Sequence

MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTASRIGGPDPASNPRLRAAVDKALANNMTRDTLNRAIARGAGNDENDNMESIVYEGYGPGGTAVMVECLTDNRKRTVSDVRHAFTKTGGNLGTDGSVAYLFTRKGIISYAPGLDEDAVMDAALEAGAEDVETFDDGAIDVYTAWEILGDVKDAMDAAGFKAESAEVSMIPSTKADLDAETAPKLMRLIDMLEDSDDVQEVYHNGDISDEVAALL

Flanking regions ( +/- flanking 50bp)

AGCGGATTTAAATGAATGAACGTCGTAAGACTTAATCTGGAGATTAGAGAATGGCAGGTCATAGTAAATGGGCCAACACCAAACACCGCAAGGCCGCGCAAGATGCGAAGCGCGGTAAAATTTTCACGAAAATCATTCGTGAATTAGTCACGGCGTCGCGCATTGGTGGTCCTGATCCTGCATCTAACCCACGTCTGCGTGCGGCAGTGGATAAAGCGTTAGCAAACAACATGACCCGCGATACCCTGAACCGTGCGATTGCACGCGGGGCGGGTAATGATGAAAACGATAACATGGAATCCATCGTATACGAAGGTTACGGCCCGGGCGGTACTGCTGTGATGGTGGAATGTCTGACGGATAACCGTAAACGTACGGTTTCTGATGTGCGCCACGCGTTCACCAAAACCGGCGGCAATCTGGGAACCGATGGCTCCGTCGCTTATCTGTTTACCCGCAAAGGTATCATTTCCTATGCACCGGGTCTGGATGAGGATGCGGTGATGGATGCGGCGCTCGAAGCCGGTGCTGAAGACGTTGAAACCTTTGACGACGGCGCTATCGACGTTTACACCGCCTGGGAAATTCTGGGTGATGTCAAAGACGCGATGGATGCAGCCGGTTTCAAAGCTGAATCTGCCGAAGTATCGATGATCCCGTCCACCAAAGCGGATCTGGATGCGGAAACCGCACCAAAACTGATGCGCCTTATCGATATGCTGGAAGACTCTGACGATGTGCAGGAAGTCTACCACAACGGCGATATCTCAGACGAAGTTGCAGCGCTGCTGTAATTTCCGTCACTCACTCCGCAGAGGATGCGCCGCTGTGCGCATCCCTCTGT