Homologs in group_581

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01665 FBDBKF_01665 100.0 Morganella morganii S1 ftnA non-heme ferritin
EHELCC_02135 EHELCC_02135 100.0 Morganella morganii S2 ftnA non-heme ferritin
NLDBIP_01325 NLDBIP_01325 100.0 Morganella morganii S4 ftnA non-heme ferritin
LHKJJB_00710 LHKJJB_00710 100.0 Morganella morganii S3 ftnA non-heme ferritin
F4V73_RS04005 F4V73_RS04005 88.7 Morganella psychrotolerans ftnA non-heme ferritin
PMI_RS04890 PMI_RS04890 76.0 Proteus mirabilis HI4320 ftnA non-heme ferritin

Distribution of the homologs in the orthogroup group_581

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_581

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P43707 2.13e-77 230 62 0 161 1 ftnA Probable bacterial non-heme ferritin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A9A1 4.25e-73 219 58 0 164 3 ftnA Bacterial non-heme ferritin Shigella flexneri
P0A998 4.25e-73 219 58 0 164 1 ftnA Bacterial non-heme ferritin Escherichia coli (strain K12)
P0A999 4.25e-73 219 58 0 164 3 ftnA Bacterial non-heme ferritin Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9A0 4.25e-73 219 58 0 164 3 ftnA Bacterial non-heme ferritin Escherichia coli O157:H7
P43708 4.32e-71 214 58 0 165 3 ftnB Probable bacterial non-heme ferritin-like protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q46106 4.61e-53 169 48 0 162 1 ftn Bacterial non-heme ferritin Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9ZLI1 4.86e-47 154 45 0 162 1 ftnA Bacterial non-heme ferritin Helicobacter pylori (strain J99 / ATCC 700824)
P52093 4.5e-46 151 44 0 162 1 ftnA Bacterial non-heme ferritin Helicobacter pylori (strain ATCC 700392 / 26695)
Q7A0H5 6.7e-30 110 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MW2)
Q6G840 6.7e-30 110 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MSSA476)
Q7A4R2 6.7e-30 110 35 0 159 1 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain N315)
Q99SZ3 6.7e-30 110 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HEN0 6.7e-30 110 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain COL)
Q2YU34 6.7e-30 110 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FWZ8 6.7e-30 110 35 0 159 1 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFK2 6.7e-30 110 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain USA300)
Q6GFG4 8.05e-30 110 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MRSA252)
Q49YT7 1.38e-29 109 36 0 166 3 ftnA Bacterial non-heme ferritin Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0A9A5 5.08e-28 105 36 0 140 3 ftnB Bacterial non-heme ferritin-like protein Shigella flexneri
P0A9A2 5.08e-28 105 36 0 140 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli (strain K12)
P0A9A3 5.08e-28 105 36 0 140 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9A4 5.08e-28 105 36 0 140 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli O157:H7
Q5HN41 6.99e-28 105 34 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CNP5 2.29e-27 103 33 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q4L7K6 2.87e-27 103 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus haemolyticus (strain JCSC1435)
P0CJ83 2.21e-26 100 32 1 160 1 ftnA Bacterial non-heme ferritin Bacteroides fragilis (strain YCH46)
E1WS50 2.21e-26 100 32 1 160 2 ftnA Bacterial non-heme ferritin Bacteroides fragilis (strain 638R)
Q26061 7.12e-13 66 32 3 153 1 None Ferritin Pacifastacus leniusculus
A0R647 5.14e-10 58 24 2 159 1 bfrB Ferritin BfrB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WNE5 1.56e-09 57 24 3 161 1 bfrB Bacterioferritin BfrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNE4 1.56e-09 57 24 3 161 3 bfrB Ferritin BfrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
H8F1Z2 1.56e-09 57 24 3 161 2 bfrB Ferritin BfrB Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
P25699 5.63e-08 53 28 5 160 2 PFE Ferritin, chloroplastic Phaseolus vulgaris
P29390 1.75e-07 52 27 4 160 1 FER2 Ferritin-2, chloroplastic Zea mays
Q94FY2 3.79e-07 51 28 5 160 3 None Ferritin, chloroplastic Malus baccata var. xiaojinensis
P19976 1.11e-06 50 27 5 160 1 None Ferritin-1, chloroplastic Glycine max
Q9S756 1.43e-06 50 29 3 144 2 FER4 Ferritin-4, chloroplastic Arabidopsis thaliana
P19975 1.43e-06 50 28 5 160 1 None Ferritin-1, chloroplastic Pisum sativum
O65100 4.33e-06 48 26 4 157 2 None Ferritin-3, chloroplastic Vigna unguiculata
Q8RX97 9.37e-06 47 28 4 157 2 FER1 Ferritin-1, chloroplastic Nicotiana tabacum
Q94IC4 9.87e-06 47 27 5 162 1 None Ferritin-2, chloroplastic Glycine max
P07798 1.03e-05 47 27 4 153 1 None Ferritin, middle subunit Aquarana catesbeiana
P85838 1.63e-05 46 27 4 153 1 None Ferritin, heavy subunit Trematomus bernacchii
P17663 2.76e-05 45 27 4 153 2 fth1-b Ferritin heavy chain B Xenopus laevis
Q96540 3.13e-05 46 26 4 157 2 LSC30 Ferritin-1, chloroplastic Brassica napus
Q948P5 5.22e-05 45 27 3 144 1 None Ferritin-4, chloroplastic Glycine max
P85837 8.72e-05 44 27 4 153 1 None Ferritin, heavy subunit Trematomus newnesi
Q948P6 0.000122 44 27 3 144 2 None Ferritin-3, chloroplastic Glycine max
P07797 0.000176 43 31 1 69 1 None Ferritin, lower subunit Aquarana catesbeiana
P29036 0.000187 43 26 5 165 1 FER1 Ferritin-1, chloroplastic Zea mays
P49946 0.000231 43 25 5 161 2 None Ferritin, heavy subunit Salmo salar
Q41709 0.000348 43 27 3 144 2 PFE2 Ferritin-2, chloroplastic Vigna unguiculata
P09528 0.000372 42 25 4 153 1 Fth1 Ferritin heavy chain Mus musculus
Q39101 0.000435 42 25 4 157 1 FER1 Ferritin-1, chloroplastic Arabidopsis thaliana
P42577 0.000519 42 25 4 152 2 None Soma ferritin Lymnaea stagnalis
Q8H1T3 0.000625 42 27 3 144 2 FER2 Ferritin-2, chloroplastic Nicotiana tabacum
O46119 0.000651 42 25 4 152 2 None Ferritin heavy chain Echinococcus granulosus
Q9XT73 0.000811 41 26 4 153 2 FTH1 Ferritin heavy chain Trichosurus vulpecula
Q9LYN2 0.000897 42 25 4 163 1 FER3 Ferritin-3, chloroplastic Arabidopsis thaliana
P19132 0.001 41 26 4 153 1 Fth1 Ferritin heavy chain Rattus norvegicus

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_00750
Feature type CDS
Gene ftnA
Product non-heme ferritin
Location 131258 - 131764 (strand: 1)
Length 507 (nucleotides) / 168 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_581
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00210 Ferritin-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1528 Inorganic ion transport and metabolism (P) P Ferritin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02217 ferritin [EC:1.16.3.2] - -

Protein Sequence

MLKPDMVNQLNAQLNLEFYSSNLYLQMSAWCADKGYEGAAAFLKAHAAEEMEHMQRLFNYLSDTGAMPLLGAIDAPPSEFSSVSDIFTLTLEHEKLITDEINKLVHAALTSQDYSTFNFLQWYVAEQHEEEKLFKSVLDKFAMVGDSGKSLFLLDKDLGRMASEPSAS

Flanking regions ( +/- flanking 50bp)

GTGCATAATGACCGCAGATGATGAAATAAACGACTGACAGGAGCCTGTATATGTTAAAGCCGGATATGGTCAACCAACTGAATGCCCAGCTGAATCTTGAATTTTATTCCTCAAATTTATATCTGCAGATGAGCGCATGGTGTGCAGATAAAGGCTACGAAGGTGCTGCCGCATTCCTGAAAGCGCACGCAGCGGAAGAAATGGAGCATATGCAGCGCCTGTTTAATTACCTCAGCGATACCGGCGCGATGCCGCTGCTCGGGGCCATTGATGCACCGCCGTCAGAATTCAGTTCAGTGAGTGATATTTTCACCCTGACGCTGGAACATGAAAAATTAATTACTGATGAAATTAATAAGCTGGTTCATGCTGCGCTGACCTCACAGGATTACTCCACCTTTAATTTCCTGCAGTGGTATGTGGCTGAGCAGCACGAAGAAGAAAAACTGTTTAAATCTGTGCTGGATAAATTCGCAATGGTGGGTGATAGTGGTAAGTCGCTGTTCCTGCTGGATAAAGATCTGGGCCGTATGGCAAGCGAACCATCCGCAAGCTGATCATTTTTAACAGCATTATTATTTATAATATAGCCACACAATTATCATAA