Homologs in group_581

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01665 FBDBKF_01665 76.0 Morganella morganii S1 ftnA non-heme ferritin
EHELCC_02135 EHELCC_02135 76.0 Morganella morganii S2 ftnA non-heme ferritin
NLDBIP_01325 NLDBIP_01325 76.0 Morganella morganii S4 ftnA non-heme ferritin
LHKJJB_00710 LHKJJB_00710 76.0 Morganella morganii S3 ftnA non-heme ferritin
HKOGLL_00750 HKOGLL_00750 76.0 Morganella morganii S5 ftnA non-heme ferritin
F4V73_RS04005 F4V73_RS04005 73.7 Morganella psychrotolerans ftnA non-heme ferritin

Distribution of the homologs in the orthogroup group_581

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_581

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9A1 1.4e-75 226 63 0 163 3 ftnA Bacterial non-heme ferritin Shigella flexneri
P0A998 1.4e-75 226 63 0 163 1 ftnA Bacterial non-heme ferritin Escherichia coli (strain K12)
P0A999 1.4e-75 226 63 0 163 3 ftnA Bacterial non-heme ferritin Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9A0 1.4e-75 226 63 0 163 3 ftnA Bacterial non-heme ferritin Escherichia coli O157:H7
P43708 1.1e-71 216 60 0 165 3 ftnB Probable bacterial non-heme ferritin-like protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P43707 3.45e-71 214 58 0 161 1 ftnA Probable bacterial non-heme ferritin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q46106 5.21e-55 174 49 0 164 1 ftn Bacterial non-heme ferritin Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9ZLI1 3.9e-48 156 45 0 164 1 ftnA Bacterial non-heme ferritin Helicobacter pylori (strain J99 / ATCC 700824)
P52093 3.03e-47 154 45 0 164 1 ftnA Bacterial non-heme ferritin Helicobacter pylori (strain ATCC 700392 / 26695)
Q5HN41 7.7e-33 117 37 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CNP5 2.38e-32 116 37 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q49YT7 2.4e-31 114 38 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L7K6 1.27e-29 109 35 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus haemolyticus (strain JCSC1435)
Q7A0H5 7.8e-29 107 33 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MW2)
Q6G840 7.8e-29 107 33 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MSSA476)
Q7A4R2 7.8e-29 107 33 0 162 1 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain N315)
Q99SZ3 7.8e-29 107 33 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HEN0 7.8e-29 107 33 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain COL)
Q2YU34 7.8e-29 107 33 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FWZ8 7.8e-29 107 33 0 162 1 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFK2 7.8e-29 107 33 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain USA300)
Q6GFG4 4.64e-28 105 32 0 162 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MRSA252)
P0A9A5 7.02e-28 105 37 0 136 3 ftnB Bacterial non-heme ferritin-like protein Shigella flexneri
P0A9A2 7.02e-28 105 37 0 136 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli (strain K12)
P0A9A3 7.02e-28 105 37 0 136 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9A4 7.02e-28 105 37 0 136 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli O157:H7
P0CJ83 9.12e-28 104 33 1 159 1 ftnA Bacterial non-heme ferritin Bacteroides fragilis (strain YCH46)
E1WS50 9.12e-28 104 33 1 159 2 ftnA Bacterial non-heme ferritin Bacteroides fragilis (strain 638R)
Q26061 2.97e-14 70 32 4 160 1 None Ferritin Pacifastacus leniusculus
P07797 4.45e-09 55 36 1 77 1 None Ferritin, lower subunit Aquarana catesbeiana
P49946 2.4e-08 53 27 4 161 2 None Ferritin, heavy subunit Salmo salar
P25699 4.57e-08 54 27 4 146 2 PFE Ferritin, chloroplastic Phaseolus vulgaris
P09528 5.5e-08 53 28 4 160 1 Fth1 Ferritin heavy chain Mus musculus
P07798 5.98e-08 53 28 4 160 1 None Ferritin, middle subunit Aquarana catesbeiana
P29390 6.12e-08 53 28 4 160 1 FER2 Ferritin-2, chloroplastic Zea mays
P25320 6.27e-08 52 29 4 154 2 SCM-2 Ferritin-2 heavy chain Schistosoma mansoni
A0R647 7.29e-08 52 26 0 121 1 bfrB Ferritin BfrB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9S756 9.34e-08 53 29 4 147 2 FER4 Ferritin-4, chloroplastic Arabidopsis thaliana
P85838 1.31e-07 52 28 4 161 1 None Ferritin, heavy subunit Trematomus bernacchii
O65100 1.69e-07 52 36 1 73 2 None Ferritin-3, chloroplastic Vigna unguiculata
Q94IC4 2.48e-07 52 35 1 78 1 None Ferritin-2, chloroplastic Glycine max
Q8RX97 3.13e-07 52 38 1 73 2 FER1 Ferritin-1, chloroplastic Nicotiana tabacum
P49948 3.53e-07 50 27 4 161 2 fth1-a Ferritin heavy chain A Xenopus laevis
P19976 5.17e-07 51 27 4 146 1 None Ferritin-1, chloroplastic Glycine max
P17663 5.39e-07 50 28 4 153 2 fth1-b Ferritin heavy chain B Xenopus laevis
P19132 6.16e-07 50 28 4 160 1 Fth1 Ferritin heavy chain Rattus norvegicus
Q94FY2 6.35e-07 50 27 4 146 3 None Ferritin, chloroplastic Malus baccata var. xiaojinensis
Q9XT73 6.42e-07 50 29 4 160 2 FTH1 Ferritin heavy chain Trichosurus vulpecula
P29389 7.35e-07 50 28 4 160 2 FTH1 Ferritin heavy chain Cricetulus griseus
P85837 7.88e-07 50 28 4 161 1 None Ferritin, heavy subunit Trematomus newnesi
Q96540 8.02e-07 50 27 4 154 2 LSC30 Ferritin-1, chloroplastic Brassica napus
P18685 1.21e-06 49 38 1 76 1 FTH1 Ferritin heavy chain Ovis aries
P19975 1.21e-06 50 28 4 146 1 None Ferritin-1, chloroplastic Pisum sativum
Q948P6 1.38e-06 50 28 4 154 2 None Ferritin-3, chloroplastic Glycine max
Q5R8J7 1.58e-06 49 29 4 160 2 FTH1 Ferritin heavy chain Pongo abelii
Q948P5 1.88e-06 49 28 4 154 1 None Ferritin-4, chloroplastic Glycine max
P42577 1.95e-06 48 27 5 161 2 None Soma ferritin Lymnaea stagnalis
P02794 2.89e-06 48 28 4 160 1 FTH1 Ferritin heavy chain Homo sapiens
P9WNE5 3.16e-06 48 24 2 147 1 bfrB Bacterioferritin BfrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNE4 3.16e-06 48 24 2 147 3 bfrB Ferritin BfrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
H8F1Z2 3.16e-06 48 24 2 147 2 bfrB Ferritin BfrB Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
Q7SXA6 3.58e-06 48 28 4 160 1 None Ferritin heavy chain, oocyte isoform Xenopus laevis
O46414 4.09e-06 48 36 1 76 1 FTH1 Ferritin heavy chain Bos taurus
Q2MHN2 6.49e-06 47 28 4 160 2 FTH1 Ferritin heavy chain Felis catus
Q95MP7 6.55e-06 47 28 4 160 2 FTH1 Ferritin heavy chain Canis lupus familiaris
Q41709 8.89e-06 47 27 4 154 2 PFE2 Ferritin-2, chloroplastic Vigna unguiculata
P08267 1.05e-05 47 35 1 76 2 FTH Ferritin heavy chain Gallus gallus
P29036 1.21e-05 47 28 4 146 1 FER1 Ferritin-1, chloroplastic Zea mays
P80145 1.23e-05 46 35 1 76 1 FTH1 Ferritin heavy chain Anas platyrhynchos
Q8H1T3 1.58e-05 47 27 4 147 2 FER2 Ferritin-2, chloroplastic Nicotiana tabacum
Q39101 1.71e-05 47 26 4 154 1 FER1 Ferritin-1, chloroplastic Arabidopsis thaliana
Q8MIP0 2.39e-05 45 28 4 160 2 FTH1 Ferritin heavy chain Equus caballus
P25319 3.4e-05 45 32 1 77 2 SCM-1 Ferritin-1 heavy chain Schistosoma mansoni
Q2YDI9 3.42e-05 45 28 4 160 2 FTMT Ferritin, mitochondrial Bos taurus
O46119 3.84e-05 45 26 4 156 2 None Ferritin heavy chain Echinococcus granulosus
P25915 4.83e-05 44 28 4 153 2 FTH1 Ferritin heavy chain (Fragment) Oryctolagus cuniculus
P07229 5.82e-05 44 25 4 160 1 None Ferritin, higher subunit Aquarana catesbeiana
P85835 5.88e-05 44 27 5 161 1 None Ferritin, middle subunit Trematomus newnesi
P85836 9.27e-05 44 27 5 161 1 None Ferritin, liver middle subunit Trematomus bernacchii
Q8N4E7 9.76e-05 44 27 4 159 1 FTMT Ferritin, mitochondrial Homo sapiens
P49947 0.000164 43 31 1 76 2 None Ferritin, middle subunit Salmo salar
P85839 0.000194 43 27 5 161 1 None Ferritin, spleen middle subunit Trematomus bernacchii
Q9LYN2 0.000198 43 26 4 154 1 FER3 Ferritin-3, chloroplastic Arabidopsis thaliana
Q9SRL5 0.000405 42 25 4 159 2 FER2 Ferritin-2, chloroplastic Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04890
Feature type CDS
Gene ftnA
Product non-heme ferritin
Location 1069964 - 1070467 (strand: 1)
Length 504 (nucleotides) / 167 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_581
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00210 Ferritin-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1528 Inorganic ion transport and metabolism (P) P Ferritin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02217 ferritin [EC:1.16.3.2] - -

Protein Sequence

MLHQDMINKLNEQLNLEFYSANLYLQMSAWCDDKGFDGAAKFLKAHSREEMEHMQRLFDYLSDTGAMPLLGTIEAPPAEFLSLSDLFTKTYEHEKFITAEINKLAHLAMTTQDYSTFNFLQWYVAEQHEEEKLFKSILDKLAMVGDGGKALFLLDKDLSALSTSAHI

Flanking regions ( +/- flanking 50bp)

AGCTGTGCATAATATCCATAATGTTAATTTTCATGGTTAGGAAGTAAAATATGTTACATCAAGATATGATCAATAAACTCAATGAACAGCTGAATCTTGAGTTTTATTCAGCTAACCTTTACCTGCAGATGAGCGCTTGGTGCGATGATAAAGGATTTGATGGCGCTGCCAAATTTTTAAAAGCACATTCCCGTGAAGAAATGGAGCATATGCAACGCTTATTTGATTATTTAAGTGATACAGGTGCTATGCCTTTGTTAGGGACTATTGAAGCACCACCTGCTGAATTTTTATCTTTATCTGATTTATTTACTAAAACTTATGAGCACGAGAAGTTTATTACAGCTGAAATTAATAAACTAGCTCACTTAGCAATGACAACACAAGATTACTCAACATTTAACTTCTTACAATGGTATGTTGCTGAACAACATGAAGAAGAGAAGTTATTTAAATCTATTCTGGATAAACTTGCTATGGTCGGTGATGGTGGTAAGGCATTGTTCTTGTTAGATAAAGACTTAAGTGCTCTTTCTACATCCGCGCATATTTAAATAATAAGAATAACTATACTGCTGTTTTAACCTGGTTGGCTAAGTGCATA