Homologs in group_581

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01665 FBDBKF_01665 88.7 Morganella morganii S1 ftnA non-heme ferritin
EHELCC_02135 EHELCC_02135 88.7 Morganella morganii S2 ftnA non-heme ferritin
NLDBIP_01325 NLDBIP_01325 88.7 Morganella morganii S4 ftnA non-heme ferritin
LHKJJB_00710 LHKJJB_00710 88.7 Morganella morganii S3 ftnA non-heme ferritin
HKOGLL_00750 HKOGLL_00750 88.7 Morganella morganii S5 ftnA non-heme ferritin
PMI_RS04890 PMI_RS04890 73.7 Proteus mirabilis HI4320 ftnA non-heme ferritin

Distribution of the homologs in the orthogroup group_581

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_581

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9A1 1.1e-75 226 62 0 161 3 ftnA Bacterial non-heme ferritin Shigella flexneri
P0A998 1.1e-75 226 62 0 161 1 ftnA Bacterial non-heme ferritin Escherichia coli (strain K12)
P0A999 1.1e-75 226 62 0 161 3 ftnA Bacterial non-heme ferritin Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9A0 1.1e-75 226 62 0 161 3 ftnA Bacterial non-heme ferritin Escherichia coli O157:H7
P43707 8.97e-74 221 60 0 161 1 ftnA Probable bacterial non-heme ferritin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P43708 7.8e-71 214 58 0 163 3 ftnB Probable bacterial non-heme ferritin-like protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q46106 1.12e-54 173 49 0 163 1 ftn Bacterial non-heme ferritin Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9ZLI1 3.04e-47 154 45 0 162 1 ftnA Bacterial non-heme ferritin Helicobacter pylori (strain J99 / ATCC 700824)
P52093 3.66e-47 154 45 0 162 1 ftnA Bacterial non-heme ferritin Helicobacter pylori (strain ATCC 700392 / 26695)
Q49YT7 2.22e-32 116 37 0 166 3 ftnA Bacterial non-heme ferritin Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L7K6 1.06e-31 114 35 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus haemolyticus (strain JCSC1435)
Q5HN41 2.08e-31 114 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CNP5 6.98e-31 112 35 0 159 3 ftnA Bacterial non-heme ferritin Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q7A0H5 2.32e-30 111 34 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MW2)
Q6G840 2.32e-30 111 34 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MSSA476)
Q6GFG4 2.32e-30 111 34 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain MRSA252)
Q7A4R2 2.32e-30 111 34 0 164 1 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain N315)
Q99SZ3 2.32e-30 111 34 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HEN0 2.32e-30 111 34 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain COL)
Q2YU34 2.32e-30 111 34 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FWZ8 2.32e-30 111 34 0 164 1 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFK2 2.32e-30 111 34 0 164 3 ftnA Bacterial non-heme ferritin Staphylococcus aureus (strain USA300)
P0A9A5 4.51e-28 105 35 0 140 3 ftnB Bacterial non-heme ferritin-like protein Shigella flexneri
P0A9A2 4.51e-28 105 35 0 140 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli (strain K12)
P0A9A3 4.51e-28 105 35 0 140 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9A4 4.51e-28 105 35 0 140 3 ftnB Bacterial non-heme ferritin-like protein Escherichia coli O157:H7
P0CJ83 8.78e-26 99 30 1 160 1 ftnA Bacterial non-heme ferritin Bacteroides fragilis (strain YCH46)
E1WS50 8.78e-26 99 30 1 160 2 ftnA Bacterial non-heme ferritin Bacteroides fragilis (strain 638R)
Q26061 4.6e-12 64 30 3 153 1 None Ferritin Pacifastacus leniusculus
P25699 1.36e-08 55 28 5 160 2 PFE Ferritin, chloroplastic Phaseolus vulgaris
A0R647 2.13e-08 54 25 2 159 1 bfrB Ferritin BfrB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WNE5 7.15e-08 52 25 3 161 1 bfrB Bacterioferritin BfrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNE4 7.15e-08 52 25 3 161 3 bfrB Ferritin BfrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
H8F1Z2 7.15e-08 52 25 3 161 2 bfrB Ferritin BfrB Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
P29390 1.47e-07 52 27 4 160 1 FER2 Ferritin-2, chloroplastic Zea mays
P07798 1.55e-07 52 28 4 153 1 None Ferritin, middle subunit Aquarana catesbeiana
P49946 1.78e-07 51 28 4 153 2 None Ferritin, heavy subunit Salmo salar
P19976 2.49e-07 52 27 4 157 1 None Ferritin-1, chloroplastic Glycine max
Q94FY2 2.69e-07 52 27 4 157 3 None Ferritin, chloroplastic Malus baccata var. xiaojinensis
Q9S756 4.96e-07 51 29 3 144 2 FER4 Ferritin-4, chloroplastic Arabidopsis thaliana
P85838 5.2e-07 50 29 4 153 1 None Ferritin, heavy subunit Trematomus bernacchii
P17663 1.48e-06 49 27 4 153 2 fth1-b Ferritin heavy chain B Xenopus laevis
O65100 1.58e-06 50 26 4 157 2 None Ferritin-3, chloroplastic Vigna unguiculata
P19975 2.09e-06 49 26 4 157 1 None Ferritin-1, chloroplastic Pisum sativum
Q8RX97 2.3e-06 49 28 4 157 2 FER1 Ferritin-1, chloroplastic Nicotiana tabacum
Q2YDI9 2.68e-06 49 28 4 159 2 FTMT Ferritin, mitochondrial Bos taurus
P85837 3.28e-06 48 29 4 153 1 None Ferritin, heavy subunit Trematomus newnesi
P49948 5.54e-06 47 26 4 153 2 fth1-a Ferritin heavy chain A Xenopus laevis
P09528 7.3e-06 47 26 4 153 1 Fth1 Ferritin heavy chain Mus musculus
P07797 1.32e-05 46 29 3 121 1 None Ferritin, lower subunit Aquarana catesbeiana
Q96540 1.97e-05 46 27 3 144 2 LSC30 Ferritin-1, chloroplastic Brassica napus
Q94IC4 2.07e-05 46 26 4 157 1 None Ferritin-2, chloroplastic Glycine max
Q9XT73 2.18e-05 46 27 4 153 2 FTH1 Ferritin heavy chain Trichosurus vulpecula
Q8H1T3 3.82e-05 45 28 3 144 2 FER2 Ferritin-2, chloroplastic Nicotiana tabacum
O46119 3.94e-05 45 26 4 154 2 None Ferritin heavy chain Echinococcus granulosus
P49947 4.86e-05 45 27 3 129 2 None Ferritin, middle subunit Salmo salar
P42577 5.42e-05 44 25 4 152 2 None Soma ferritin Lymnaea stagnalis
Q948P5 5.8e-05 45 27 3 144 1 None Ferritin-4, chloroplastic Glycine max
P25915 7.92e-05 44 26 4 153 2 FTH1 Ferritin heavy chain (Fragment) Oryctolagus cuniculus
Q7SXA6 8.37e-05 44 26 4 153 1 None Ferritin heavy chain, oocyte isoform Xenopus laevis
Q5R8J7 0.000104 44 27 4 153 2 FTH1 Ferritin heavy chain Pongo abelii
P85836 0.000106 43 27 3 127 1 None Ferritin, liver middle subunit Trematomus bernacchii
P85835 0.000109 43 27 3 124 1 None Ferritin, middle subunit Trematomus newnesi
P29389 0.000113 43 26 4 153 2 FTH1 Ferritin heavy chain Cricetulus griseus
P29036 0.000117 44 29 4 131 1 FER1 Ferritin-1, chloroplastic Zea mays
Q948P6 0.000132 44 27 3 144 2 None Ferritin-3, chloroplastic Glycine max
P19132 0.000133 43 26 4 153 1 Fth1 Ferritin heavy chain Rattus norvegicus
P85839 0.000141 43 26 3 127 1 None Ferritin, spleen middle subunit Trematomus bernacchii
P02794 0.000183 43 26 4 153 1 FTH1 Ferritin heavy chain Homo sapiens
Q8N4E7 0.000196 43 25 4 158 1 FTMT Ferritin, mitochondrial Homo sapiens
O46414 0.000209 43 26 4 153 1 FTH1 Ferritin heavy chain Bos taurus
Q95MP7 0.000232 43 26 4 153 2 FTH1 Ferritin heavy chain Canis lupus familiaris
Q2MHN2 0.000263 43 26 4 153 2 FTH1 Ferritin heavy chain Felis catus
Q39101 0.000431 42 25 3 144 1 FER1 Ferritin-1, chloroplastic Arabidopsis thaliana
Q9LYN2 0.000435 42 25 4 163 1 FER3 Ferritin-3, chloroplastic Arabidopsis thaliana
Q41709 0.000463 42 27 3 144 2 PFE2 Ferritin-2, chloroplastic Vigna unguiculata
P18685 0.000748 41 28 3 124 1 FTH1 Ferritin heavy chain Ovis aries

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04005
Feature type CDS
Gene ftnA
Product non-heme ferritin
Location 848764 - 849270 (strand: 1)
Length 507 (nucleotides) / 168 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_581
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00210 Ferritin-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1528 Inorganic ion transport and metabolism (P) P Ferritin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02217 ferritin [EC:1.16.3.2] - -

Protein Sequence

MLKPDMIKQLNAQLNLEFYSSNLYLQMSAWCADKGYEGAAAFLKAHAAEEMEHMHRLFNYLSDTGALPLLGTVQAPPSEFKSVSEIFEQTLEHEKLITQEINKLAHVALTSQDYSTFNFLQWYVSEQHEEEKLFKSVLDKFAMVGDSGKSLFLLDKDLARMAVDPSAC

Flanking regions ( +/- flanking 50bp)

GTGCATAATGACCGCAGATGATGAAATAAACGACCGCACAGGAGTTTGCTATGTTAAAACCGGATATGATTAAACAACTGAATGCCCAGCTGAATCTGGAATTCTATTCTTCAAACTTATATTTACAGATGAGTGCATGGTGCGCGGATAAAGGTTACGAAGGCGCTGCAGCGTTCCTGAAAGCCCATGCTGCCGAAGAAATGGAGCATATGCACCGCCTGTTTAATTACCTCAGTGACACCGGCGCACTGCCGCTGCTGGGAACGGTTCAGGCACCGCCGTCAGAATTCAAATCTGTCAGTGAAATTTTTGAGCAGACCTTGGAGCATGAAAAATTAATCACACAGGAAATTAACAAACTGGCTCATGTTGCGCTGACGTCACAAGATTATTCCACCTTTAACTTCCTGCAATGGTATGTGTCTGAGCAGCATGAAGAAGAGAAATTATTCAAATCTGTTCTGGATAAATTCGCAATGGTGGGTGACAGCGGAAAATCACTGTTCCTGCTGGATAAAGATTTGGCGCGTATGGCCGTTGATCCATCAGCCTGCTGATTTGTTTATCATTCAGGATGCAGCCAACGAACCTGCAGGTTGAATGAATC