Homologs in group_127

Help

10 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17330 FBDBKF_17330 96.9 Morganella morganii S1 dinP Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair
EHELCC_01560 EHELCC_01560 96.9 Morganella morganii S2 dinP Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair
EHELCC_19370 EHELCC_19370 100.0 Morganella morganii S2 - DUF4113 domain-containing protein
NLDBIP_01900 NLDBIP_01900 96.9 Morganella morganii S4 dinP Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair
NLDBIP_19500 NLDBIP_19500 100.0 Morganella morganii S4 - DUF4113 domain-containing protein
LHKJJB_00135 LHKJJB_00135 96.9 Morganella morganii S3 dinP Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair
LHKJJB_19450 LHKJJB_19450 100.0 Morganella morganii S3 - DUF4113 domain-containing protein
HKOGLL_00175 HKOGLL_00175 96.9 Morganella morganii S5 dinP Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair
HKOGLL_19380 HKOGLL_19380 100.0 Morganella morganii S5 - DUF4113 domain-containing protein
PMI_RS12285 PMI_RS12285 57.6 Proteus mirabilis HI4320 umuC translesion error-prone DNA polymerase V subunit UmuC

Distribution of the homologs in the orthogroup group_127

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_127

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P18642 5.26e-31 115 53 0 94 3 impB Protein ImpB Salmonella typhimurium
P23832 1.94e-30 114 49 0 95 3 samB Protein SamB Salmonella typhimurium
P22494 1.02e-21 90 44 1 96 3 umuC Protein UmuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04152 1.21e-20 87 45 1 95 1 umuC Protein UmuC Escherichia coli (strain K12)
P07375 2.5e-18 81 40 1 92 3 mucB Protein MucB Escherichia coli
P14303 2.68e-17 78 40 1 87 3 mucB Protein MucB Salmonella typhimurium

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_20095
Feature type CDS
Gene -
Product DUF4113 domain-containing protein
Location 4656 - 4946 (strand: 1)
Length 291 (nucleotides) / 96 (amino acids)
In genomic island -

Contig

Accession contig_47
Length 12696 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_127
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Domains

PF13438 Domain of unknown function (DUF4113)

Protein Sequence

MRALDSIWCDGYRYYKAGIILSDFTDSAITQFDMFATRQPFKNSDELMKTIDTINNSGIGRVWFAGKGSDSGYKMKREMLSPAYTTNFSQLPVVKS

Flanking regions ( +/- flanking 50bp)

TTTCACTCGAGTGCCTCAGCTGCGACACGCGGGACATCATCAATGCCGCCATGAGAGCACTGGATAGTATCTGGTGTGACGGCTACCGGTATTATAAGGCTGGCATCATCCTGTCTGACTTCACGGATTCAGCTATCACGCAGTTCGATATGTTCGCCACCCGGCAGCCATTCAAAAACAGCGATGAGCTGATGAAGACCATCGACACGATCAATAACAGCGGCATAGGTCGCGTGTGGTTTGCTGGTAAAGGCAGCGACAGCGGGTACAAGATGAAGCGCGAAATGTTGTCACCGGCATACACGACAAATTTTAGTCAGTTGCCGGTGGTGAAAAGTTAATGTGTCCATTTAGGCGATGAAGCGCGTTGAGATGGAATACGTTTTTTCAC