Homologs in group_3072

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17005 EHELCC_17005 100.0 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_18385 NLDBIP_18385 100.0 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
LHKJJB_09240 LHKJJB_09240 100.0 Morganella morganii S3 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_08790 HKOGLL_08790 100.0 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
F4V73_RS13785 F4V73_RS13785 97.4 Morganella psychrotolerans - LysR substrate-binding domain-containing protein

Distribution of the homologs in the orthogroup group_3072

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3072

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9F6 2.25e-41 148 31 3 295 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 2.25e-41 148 31 3 295 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 2.25e-41 148 31 3 295 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
P14145 9.7e-31 120 29 6 296 3 ampR HTH-type transcriptional activator AmpR Rhodobacter capsulatus
P52676 4.64e-30 118 29 9 301 3 nmcR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Enterobacter cloacae
P52658 3.76e-29 115 27 6 291 3 ampR HTH-type transcriptional activator AmpR Citrobacter koseri
P34818 9.72e-29 114 30 3 262 3 trpI HTH-type transcriptional regulator TrpI Pseudomonas syringae pv. syringae
P45099 1.59e-28 114 27 7 303 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P46068 7.17e-28 112 28 5 290 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
P24734 1.48e-27 111 29 9 299 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P11720 2.09e-27 111 29 3 262 1 trpI HTH-type transcriptional regulator TrpI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P05051 1.48e-26 108 28 5 288 3 ampR HTH-type transcriptional activator AmpR Enterobacter cloacae
P52683 3.28e-25 105 27 8 298 3 smeR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Serratia marcescens
P45461 4.39e-25 105 26 7 293 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
P52660 9.62e-25 103 27 6 295 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
Q57083 2.99e-24 102 30 6 254 1 perR HTH-type transcriptional regulator PerR Escherichia coli (strain K12)
P55576 1.41e-23 100 28 7 287 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P12529 8.57e-23 98 27 6 291 1 ampR HTH-type transcriptional activator AmpR Citrobacter freundii
O69772 2.48e-20 92 28 6 290 3 ampR HTH-type transcriptional activator AmpR Providencia stuartii
P30864 2.8e-16 80 25 8 296 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
Q9JPU9 1.49e-14 75 26 9 293 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
Q9JXW7 5.14e-14 74 26 9 293 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P55181 6.65e-14 73 23 9 295 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
Q06610 1.84e-13 72 38 2 116 3 rbcR RuBisCO operon transcriptional regulator Acidithiobacillus ferrooxidans
P42507 3.47e-13 72 29 3 161 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O34685 4.84e-13 71 27 7 294 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
P25544 5.67e-12 68 26 11 295 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
O32186 6.3e-11 65 26 6 251 3 yusT Uncharacterized HTH-type transcriptional regulator YusT Bacillus subtilis (strain 168)
Q5N5I5 7.4e-11 65 35 3 120 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 7.4e-11 65 35 3 120 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8X4M5 8.54e-11 65 32 2 122 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
P27111 1e-10 64 32 2 122 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
P33634 1.69e-10 64 25 9 263 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
Q55459 3.9e-10 63 22 8 289 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P37641 1.27e-09 61 25 11 300 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
P45349 1.28e-09 61 26 8 261 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52696 2.21e-09 60 28 2 164 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
A2CI69 4.89e-09 60 25 8 263 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
P77333 7.54e-09 59 21 7 262 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
P48271 1.56e-08 58 26 9 258 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
P43011 2.71e-08 57 24 7 270 3 HI_1364 Uncharacterized HTH-type transcriptional regulator HI_1364 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8YQ82 2.85e-08 57 25 6 268 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1XDT2 2.96e-08 57 24 7 258 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
Q3MCB5 2.98e-08 57 25 6 268 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q47141 3.01e-08 57 29 4 162 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
P96725 4.16e-08 57 23 7 291 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
P51205 6.24e-08 56 24 7 258 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
Q44311 6.58e-08 56 23 6 238 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
P0A2Q4 1.23e-07 55 24 8 254 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 1.23e-07 55 24 8 254 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
P52689 1.62e-07 55 22 4 253 3 ltrA Probable HTH-type transcriptional regulator LtrA Klebsiella pneumoniae
Q6B936 2.84e-07 54 23 7 260 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
A0R8S0 2.88e-07 54 23 10 295 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
P0A9G1 3.4e-07 54 23 8 254 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 3.4e-07 54 23 8 254 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 3.4e-07 54 23 8 254 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
Q8KA72 4e-07 54 22 8 284 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P20668 4.24e-07 53 32 1 112 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
P96194 4.36e-07 52 40 1 79 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
P52595 7.09e-07 53 26 3 168 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
Q9X5P2 7.73e-07 53 25 1 128 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
O78432 8.11e-07 53 23 9 264 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
P52659 9.2e-07 53 26 9 260 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus
O32255 1.08e-06 52 31 5 120 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
Q9HWH8 1.16e-06 52 31 1 128 3 nmoR HTH-type transcriptional regulator NmoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q47005 1.28e-06 52 22 6 245 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
P37499 1.87e-06 52 30 3 117 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
P42722 2.11e-06 52 29 2 117 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P77171 2.42e-06 52 26 4 164 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
O06703 2.42e-06 52 36 0 80 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P25545 2.77e-06 51 27 3 147 3 cbbR HTH-type transcriptional regulator CbbR Xanthobacter flavus
Q85G62 5.87e-06 50 24 11 272 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P49518 8.8e-06 50 27 1 116 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P73123 1.05e-05 50 24 6 260 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P16931 1.54e-05 49 24 1 128 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
B1JQ39 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 1.76e-05 49 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q4G384 2.05e-05 48 23 7 261 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
Q01610 2.08e-05 48 31 0 77 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39592 2.22e-05 48 24 2 121 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
P75836 3.12e-05 48 22 1 135 3 ycaN Uncharacterized HTH-type transcriptional regulator YcaN Escherichia coli (strain K12)
P52678 3.37e-05 48 22 8 312 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
P0ACR8 3.78e-05 48 29 2 117 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 3.78e-05 48 29 2 117 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
P52691 3.84e-05 48 32 4 128 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0T0G2 5.52e-05 47 25 1 121 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
P42427 5.63e-05 47 26 3 131 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P03030 5.85e-05 47 27 2 124 3 lysR Transcriptional activator protein LysR Escherichia coli (strain K12)
A0T0V5 6.32e-05 47 21 6 264 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P0ACR0 6.46e-05 47 38 0 73 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 6.46e-05 47 38 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
B4TNR5 7.45e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella schwarzengrund (strain CVM19633)
Q329U3 7.48e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella dysenteriae serotype 1 (strain Sd197)
B6I4A0 7.48e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SE11)
B7M5B2 7.48e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O8 (strain IAI1)
B5YY14 7.48e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAW1 7.48e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7
B7L8A6 7.48e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain 55989 / EAEC)
A7ZTW7 7.48e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YVK2 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella sonnei (strain Ss046)
P0A8S0 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri
Q0SYV7 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri serotype 5b (strain 8401)
Q31UM0 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 4 (strain Sb227)
B2TU26 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLU0 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SMS-3-5 / SECEC)
P0A8R9 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12)
B1IWY2 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6M0 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O9:H4 (strain HS)
B1X9Y2 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / DH10B)
C4ZZ35 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / MC4100 / BW2952)
B7UMM1 7.76e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B4SYF7 7.79e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella newport (strain SL254)
Q1R4H3 7.83e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain UTI89 / UPEC)
P59369 7.83e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAV4 7.83e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N260 7.83e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O81 (strain ED1a)
B7MGH6 7.83e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NU32 7.9e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5FN59 8.08e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella dublin (strain CT_02021853)
P0A2Q0 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q1 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhi
B5BIR0 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain AKU_12601)
C0Q2U0 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi C (strain RKS4594)
A9MXD5 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJZ0 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAZ8 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella heidelberg (strain SL476)
B5EZ22 8.16e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella agona (strain SL483)
B7NF72 8.19e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7LUJ5 8.27e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RF30 8.79e-05 47 38 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 8.79e-05 47 38 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
Q8FK66 9.2e-05 47 38 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 9.2e-05 47 38 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P77700 0.000126 46 35 0 68 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
P0ACQ9 0.000131 46 25 13 286 3 tdcA HTH-type transcriptional regulator TdcA Shigella flexneri
P0ACQ7 0.000131 46 25 13 286 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli (strain K12)
P0ACQ8 0.000131 46 25 13 286 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli O157:H7
P39376 0.00015 46 22 7 260 1 yjiE HTH-type transcriptional regulator YjiE Escherichia coli (strain K12)
O87324 0.00017 46 20 7 311 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
A1JI47 0.000203 45 46 0 63 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A0A0H2ZDG9 0.000227 45 25 3 126 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
P20667 0.000236 45 26 9 240 3 catR HTH-type transcriptional regulator CatR Pseudomonas putida
P94387 0.000253 45 23 2 115 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
P74422 0.000266 45 29 3 141 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O33945 0.000268 45 26 4 158 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
P70785 0.000328 45 26 3 163 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
O19892 0.000534 44 21 9 273 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
Q04778 0.000561 44 23 1 121 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
A5F9F9 0.000733 44 28 2 118 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q765S2 0.000774 43 32 1 82 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
P0C6D1 0.000788 43 28 2 118 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18810
Feature type CDS
Gene lysR
Product DNA-binding transcriptional regulator, LysR family
Location 9102 - 10013 (strand: -1)
Length 912 (nucleotides) / 303 (amino acids)

Contig

Accession contig_36
Length 27638 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3072
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03566 LysR family transcriptional regulator, glycine cleavage system transcriptional activator Biofilm formation - Escherichia coli -

Protein Sequence

MRKKIPKTDLLITFEAVAQYESYTRAAEELSLTQSAVFRQIAALEEFLNVSLFHHVRKRIFLSDAGKHYLGLVHDTLDKLEKDTQDIMSWQSSQQLFELAVTPTFSTHWLIPNLQSFREKHPEIALSISALTTPADFTSLKYDAAIMREDFCNPWPDFEYLFEEELVPVCSRMLWRDDSIKLTTSQVLEEFTLLHQTTRLDAWSDWFQLSGIHNPKTRVGPRFDLLSMLISAIRSNLGVALLPRFAIQKDLENGDLVIPCDLPMSTGNRFVLTYKEDKKGSLNLRKFSDWIHEKSREKELILS

Flanking regions ( +/- flanking 50bp)

GCCATCCCCCACCCGGTAAAATGGATTATATTTTTAGGGAGTAAAACGCCATGCGAAAGAAGATCCCGAAAACGGATTTACTGATCACCTTCGAAGCTGTTGCGCAGTATGAGAGCTACACCCGGGCAGCGGAAGAGTTATCACTGACCCAGAGTGCGGTTTTCCGTCAGATCGCCGCGCTGGAAGAATTTCTGAATGTGTCGCTGTTTCATCACGTCCGCAAACGTATTTTCCTCAGTGATGCCGGAAAGCATTACCTCGGGCTGGTGCATGACACGCTGGATAAGCTGGAAAAAGACACCCAGGATATTATGTCCTGGCAGTCATCACAGCAGCTGTTTGAGCTGGCGGTAACACCGACCTTCAGCACACACTGGCTGATCCCGAACCTGCAGAGCTTCCGTGAGAAACATCCGGAAATCGCATTAAGTATTAGCGCATTAACCACACCGGCGGACTTTACCAGCCTGAAATACGATGCGGCGATCATGCGTGAGGATTTCTGTAATCCGTGGCCGGATTTTGAATATCTGTTTGAGGAAGAGCTGGTACCGGTCTGCAGCCGCATGCTGTGGCGGGATGACAGTATCAAACTCACCACCAGCCAGGTGCTGGAAGAATTTACTCTGCTGCATCAGACCACCCGCCTCGATGCCTGGAGTGACTGGTTCCAGCTCTCGGGCATTCACAACCCGAAAACCCGGGTCGGCCCGCGCTTTGATCTGCTTTCGATGCTGATCTCCGCTATCCGCTCAAATCTCGGTGTGGCGCTGCTGCCGCGTTTTGCTATCCAGAAAGATCTGGAAAACGGCGATCTGGTGATCCCGTGCGACCTGCCGATGAGCACCGGCAACCGCTTTGTTCTTACCTATAAAGAGGACAAAAAAGGATCACTCAACCTGCGGAAATTCAGTGACTGGATCCACGAGAAATCGCGGGAAAAAGAACTGATTTTGTCCTGATAAAAAAGGTGGCTCAGCCACCTTTTTTATTATCCGGAACACTTACTGTT