Homologs in group_3073

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18810 FBDBKF_18810 97.4 Morganella morganii S1 lysR DNA-binding transcriptional regulator, LysR family
EHELCC_17005 EHELCC_17005 97.4 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_18385 NLDBIP_18385 97.4 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
LHKJJB_09240 LHKJJB_09240 97.4 Morganella morganii S3 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_08790 HKOGLL_08790 97.4 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family

Distribution of the homologs in the orthogroup group_3073

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3073

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9F6 1.65e-42 151 31 2 294 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 1.65e-42 151 31 2 294 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 1.65e-42 151 31 2 294 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
P14145 1.47e-30 119 29 6 295 3 ampR HTH-type transcriptional activator AmpR Rhodobacter capsulatus
P52676 1.09e-29 117 30 9 300 3 nmcR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Enterobacter cloacae
P52658 4.18e-28 112 27 6 290 3 ampR HTH-type transcriptional activator AmpR Citrobacter koseri
P45099 6.3e-28 112 27 7 302 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P34818 7.09e-28 112 31 4 262 3 trpI HTH-type transcriptional regulator TrpI Pseudomonas syringae pv. syringae
P46068 8.53e-28 112 30 4 267 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
P52683 4.89e-27 110 28 9 299 3 smeR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Serratia marcescens
P24734 2.02e-26 108 29 10 295 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P11720 1.12e-25 106 29 5 263 1 trpI HTH-type transcriptional regulator TrpI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P05051 2.29e-25 105 27 5 287 3 ampR HTH-type transcriptional activator AmpR Enterobacter cloacae
Q57083 1.54e-24 103 30 6 253 1 perR HTH-type transcriptional regulator PerR Escherichia coli (strain K12)
P52660 1.76e-24 103 27 6 294 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
P45461 8.13e-24 101 25 7 292 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
P55576 6.17e-23 99 28 7 286 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P12529 6.29e-22 96 27 6 290 1 ampR HTH-type transcriptional activator AmpR Citrobacter freundii
O69772 6.97e-21 93 28 6 289 3 ampR HTH-type transcriptional activator AmpR Providencia stuartii
P30864 9.76e-16 79 25 7 293 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
P55181 1.95e-14 75 23 11 297 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
Q9JPU9 2.66e-14 75 26 9 289 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
Q9JXW7 1.15e-13 73 26 9 289 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q06610 2.94e-13 72 38 2 116 3 rbcR RuBisCO operon transcriptional regulator Acidithiobacillus ferrooxidans
O34685 1.64e-12 70 26 7 293 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
P42507 4.78e-12 68 25 9 299 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P25544 5.83e-12 68 26 10 292 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
Q5N5I5 1.47e-11 67 35 3 120 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 1.47e-11 67 35 3 120 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O32186 5.52e-11 65 25 6 252 3 yusT Uncharacterized HTH-type transcriptional regulator YusT Bacillus subtilis (strain 168)
Q8X4M5 8.86e-11 65 32 2 122 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
P27111 1.06e-10 64 32 2 122 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
P33634 1.49e-10 64 27 8 257 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
Q55459 1.84e-10 63 23 10 290 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P52696 8.09e-10 62 28 2 164 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
Q8YQ82 1.23e-09 62 24 4 260 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P45349 1.42e-09 61 27 8 260 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3MCB5 1.61e-09 61 24 4 260 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8KA72 3.61e-09 60 24 7 283 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0A2Q4 1.19e-08 58 25 9 255 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 1.19e-08 58 25 9 255 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
P48271 1.5e-08 58 24 8 262 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
Q1XDT2 1.54e-08 58 25 8 260 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
P77333 1.63e-08 58 25 1 137 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
Q47141 2.48e-08 57 27 1 159 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
P51205 3.02e-08 57 24 8 260 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
P37641 5.18e-08 56 24 11 303 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
P52659 6.65e-08 56 24 8 297 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus
P43011 6.93e-08 56 23 5 265 3 HI_1364 Uncharacterized HTH-type transcriptional regulator HI_1364 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44311 7.79e-08 56 25 7 241 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
P0A9G1 8.61e-08 56 23 8 256 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 8.61e-08 56 23 8 256 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 8.61e-08 56 23 8 256 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
O78432 8.66e-08 56 25 10 271 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
P96725 1.01e-07 55 27 0 116 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
A2CI69 1.46e-07 55 25 10 266 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
Q6B936 1.77e-07 55 24 8 272 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
P73123 3.04e-07 54 22 5 261 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P20668 3.38e-07 54 32 1 112 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
Q85G62 3.39e-07 54 31 5 133 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P52689 3.51e-07 54 22 5 254 3 ltrA Probable HTH-type transcriptional regulator LtrA Klebsiella pneumoniae
P42722 4.4e-07 53 29 2 117 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P96194 1.09e-06 50 39 1 79 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
A0R8S0 1.98e-06 52 24 8 247 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
P37499 2.25e-06 52 30 3 117 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
O87883 2.65e-06 50 28 1 124 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
O06703 3.92e-06 51 36 0 80 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P52595 4.89e-06 50 26 3 156 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
O32255 5.28e-06 50 30 5 120 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
Q9X5P2 5.66e-06 50 24 1 128 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
P25545 6.22e-06 50 26 3 147 3 cbbR HTH-type transcriptional regulator CbbR Xanthobacter flavus
Q01610 6.23e-06 50 32 0 77 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P75836 7.56e-06 50 22 1 135 3 ycaN Uncharacterized HTH-type transcriptional regulator YcaN Escherichia coli (strain K12)
P77171 8.52e-06 50 26 4 164 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
Q9HWH8 1.07e-05 49 29 1 128 3 nmoR HTH-type transcriptional regulator NmoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P49518 1.18e-05 49 27 1 116 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P39592 1.37e-05 49 25 2 121 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
Q47005 1.66e-05 49 24 7 250 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
B1JQ39 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 1.97e-05 48 34 2 121 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P16931 2.65e-05 48 24 1 128 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
P20667 3.95e-05 48 25 7 236 3 catR HTH-type transcriptional regulator CatR Pseudomonas putida
P74422 3.98e-05 48 29 3 141 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P52678 4.16e-05 48 21 8 311 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
P52693 6.04e-05 47 25 2 126 3 ntcB Probable nitrogen assimilation transcriptional activator Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O19892 6.19e-05 47 28 5 133 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
P46924 6.36e-05 47 26 9 269 3 leuO Probable HTH-type transcriptional regulator LeuO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0T0G2 7.53e-05 47 25 1 121 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
A0A0H2ZDG9 8.05e-05 47 22 8 304 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
P03030 8.58e-05 47 27 2 124 3 lysR Transcriptional activator protein LysR Escherichia coli (strain K12)
B5FN59 9.21e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella dublin (strain CT_02021853)
B4TNR5 9.29e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella schwarzengrund (strain CVM19633)
B4SYF7 9.29e-05 47 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella newport (strain SL254)
A0T0V5 9.7e-05 47 23 3 166 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P0A2Q0 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q1 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhi
B5BIR0 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain AKU_12601)
C0Q2U0 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi C (strain RKS4594)
A9MXD5 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJZ0 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAZ8 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella heidelberg (strain SL476)
B5EZ22 9.81e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Salmonella agona (strain SL483)
Q329U3 9.85e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella dysenteriae serotype 1 (strain Sd197)
B6I4A0 9.85e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SE11)
B7M5B2 9.85e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O8 (strain IAI1)
B5YY14 9.85e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAW1 9.85e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7
B7L8A6 9.85e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain 55989 / EAEC)
A7ZTW7 9.85e-05 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R4H3 0.000101 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain UTI89 / UPEC)
P59369 0.000101 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAV4 0.000101 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N260 0.000101 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O81 (strain ED1a)
B7MGH6 0.000101 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3YVK2 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella sonnei (strain Ss046)
P0A8S0 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri
Q0SYV7 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri serotype 5b (strain 8401)
Q31UM0 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 4 (strain Sb227)
B2TU26 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLU0 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SMS-3-5 / SECEC)
B7NF72 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8R9 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12)
B1IWY2 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6M0 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O9:H4 (strain HS)
B1X9Y2 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / DH10B)
C4ZZ35 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / MC4100 / BW2952)
B7UMM1 0.000102 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7NU32 0.000104 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LUJ5 0.000107 46 47 0 63 3 hdfR HTH-type transcriptional regulator HdfR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P0ACQ9 0.000109 46 24 11 285 3 tdcA HTH-type transcriptional regulator TdcA Shigella flexneri
P0ACQ7 0.000109 46 24 11 285 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli (strain K12)
P0ACQ8 0.000109 46 24 11 285 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli O157:H7
P72131 0.000114 46 24 7 262 1 ptxR HTH-type transcriptional regulator PtxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0ACR8 0.000118 46 29 2 117 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 0.000118 46 29 2 117 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
O87324 0.000214 45 21 7 291 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
O33945 0.000228 45 25 6 199 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
A1JI47 0.000233 45 46 0 63 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P70785 0.00024 45 27 3 163 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P39376 0.000252 45 22 7 259 1 yjiE HTH-type transcriptional regulator YjiE Escherichia coli (strain K12)
P52691 0.00033 45 31 3 128 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P77700 0.000341 45 36 0 60 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
P0ACR0 0.000399 45 36 0 73 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 0.000399 45 36 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
Q765S2 0.000466 44 34 1 82 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
Q8FK66 0.000604 44 36 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 0.000604 44 36 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RF30 0.000626 44 36 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 0.000626 44 36 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
A5F9F9 0.000748 44 29 2 126 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0C6D1 0.000762 44 29 2 126 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P42427 0.000764 43 25 3 131 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13785
Feature type CDS
Gene -
Product LysR substrate-binding domain-containing protein
Location 389921 - 390829 (strand: 1)
Length 909 (nucleotides) / 302 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3073
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03566 LysR family transcriptional regulator, glycine cleavage system transcriptional activator Biofilm formation - Escherichia coli -

Protein Sequence

MRKKIPKTDLLITFEAVAQYESYTRAAEELSLTQSAVFRQIAGLEEFLNVSLFHHVRKRIFLSDAGKHYLGLVHETLDKLEKDTQDIMSWQSSQQLFELAVTPTFSTHWLIPNLQGFREKHPEIALSISALTTPSDFTSLKYDAAIMREDFCNPWPDFEYLFEEELVPVCSRMLCDDSVKLTTSQVLEEFTLLHQTTRLDAWSDWFQLSGIHNPKTRVGPRFDLLSMLISAIRSNLGVALLPRFAIQKDLENGDLVIPCDLPMSTGNRFVLTYKEDKKGSLNLRKFSDWIHQKSREKELILP

Flanking regions ( +/- flanking 50bp)

CGCCGTCTCCGACCCGGTAAAATGGATATTTTTTTAGGGAGTAAAACGCAATGCGAAAGAAGATCCCAAAAACGGATTTGCTGATAACCTTTGAGGCTGTCGCACAATATGAAAGCTACACGCGGGCAGCCGAAGAGTTATCACTGACCCAGAGTGCCGTTTTCCGCCAGATAGCCGGGCTGGAAGAATTTTTAAATGTCTCGCTGTTCCATCACGTCCGTAAACGTATTTTCCTCAGTGATGCGGGAAAACATTACCTCGGGCTGGTGCATGAAACGCTGGATAAACTGGAAAAAGACACGCAGGATATTATGTCCTGGCAATCCTCTCAGCAACTGTTTGAACTGGCGGTCACGCCGACATTCAGTACACACTGGCTTATCCCTAATCTTCAGGGATTTCGTGAGAAACATCCGGAAATCGCATTGAGTATCAGTGCATTAACCACACCATCAGATTTTACCAGCCTGAAATATGACGCGGCAATTATGCGGGAAGATTTCTGTAACCCGTGGCCGGACTTTGAATATCTGTTTGAAGAAGAACTGGTACCGGTATGCAGCCGGATGCTGTGTGATGACAGTGTAAAACTCACCACCAGCCAGGTACTGGAAGAATTTACCCTGCTGCACCAGACCACACGGCTGGACGCGTGGAGTGACTGGTTCCAGCTTTCCGGAATTCATAACCCGAAAACCCGTGTCGGTCCGCGCTTTGATTTGCTCTCTATGCTTATCTCCGCGATCCGCTCCAATCTCGGTGTGGCACTTCTGCCGCGATTTGCGATACAAAAAGATCTGGAAAACGGCGATTTGGTTATTCCGTGCGACCTGCCGATGAGCACCGGCAACCGCTTTGTTCTCACCTATAAAGAGGACAAAAAAGGATCCCTGAATCTGCGTAAATTCAGTGACTGGATCCACCAGAAATCACGGGAAAAAGAACTGATATTGCCTTAATACCGGACGAAAAAAGTGATACCTCGCGGTATCACTTTTTCTTTTGCATC