Homologs in group_2364

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_18280 EHELCC_18280 100.0 Morganella morganii S2 - DUF486 domain-containing protein
NLDBIP_18205 NLDBIP_18205 100.0 Morganella morganii S4 - DUF486 domain-containing protein
LHKJJB_18400 LHKJJB_18400 100.0 Morganella morganii S3 - DUF486 domain-containing protein
HKOGLL_18135 HKOGLL_18135 100.0 Morganella morganii S5 - DUF486 domain-containing protein
F4V73_RS01775 F4V73_RS01775 87.7 Morganella psychrotolerans - DMT family protein
PMI_RS09560 PMI_RS09560 76.3 Proteus mirabilis HI4320 - DMT family protein

Distribution of the homologs in the orthogroup group_2364

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2364

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18245
Feature type CDS
Gene -
Product DUF486 domain-containing protein
Location 14387 - 14731 (strand: 1)
Length 345 (nucleotides) / 114 (amino acids)
In genomic island -

Contig

Accession contig_33
Length 35117 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2364
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04342 Putative member of DMT superfamily (DUF486)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3169 Function unknown (S) S Uncharacterized membrane protein, DMT/DUF486 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09922 uncharacterized protein - -

Protein Sequence

MLAKFLPIFLLVLSNIFMMFAWYGHLKFAGKPLIAVIFFSWLIALAEYCLAVPANRIGHQYYSAAELKTMQEVITLCVFMVFSVAYLGESITLNHLIGFGFIAAGAFFIFKGPF

Flanking regions ( +/- flanking 50bp)

GATCGGCGTAAAATAGCGGCTGATATCATTTTTTACTGACGGATCCCCCTATGCTGGCGAAGTTTCTCCCGATTTTTCTGCTTGTTCTCTCCAATATTTTTATGATGTTTGCCTGGTACGGACACCTGAAGTTTGCCGGTAAACCCCTTATTGCTGTGATTTTTTTCAGCTGGCTGATTGCGCTGGCGGAATATTGTCTGGCGGTGCCGGCCAACCGGATCGGTCATCAGTACTACAGTGCCGCCGAGCTGAAAACTATGCAGGAAGTGATCACTCTGTGTGTCTTTATGGTATTTTCTGTCGCTTATCTGGGTGAAAGCATCACGCTGAATCACCTTATCGGCTTCGGATTTATTGCCGCCGGGGCTTTCTTTATTTTTAAAGGACCGTTTTAACCGCCACCACACAATGACGATAACGATACTGTGAATTTATCCATAATATA