Homologs in group_2364

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18245 FBDBKF_18245 87.7 Morganella morganii S1 - DUF486 domain-containing protein
EHELCC_18280 EHELCC_18280 87.7 Morganella morganii S2 - DUF486 domain-containing protein
NLDBIP_18205 NLDBIP_18205 87.7 Morganella morganii S4 - DUF486 domain-containing protein
LHKJJB_18400 LHKJJB_18400 87.7 Morganella morganii S3 - DUF486 domain-containing protein
HKOGLL_18135 HKOGLL_18135 87.7 Morganella morganii S5 - DUF486 domain-containing protein
PMI_RS09560 PMI_RS09560 71.9 Proteus mirabilis HI4320 - DMT family protein

Distribution of the homologs in the orthogroup group_2364

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2364

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01775
Feature type CDS
Gene -
Product DMT family protein
Location 392485 - 392829 (strand: 1)
Length 345 (nucleotides) / 114 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2364
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04342 Putative member of DMT superfamily (DUF486)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3169 Function unknown (S) S Uncharacterized membrane protein, DMT/DUF486 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09922 uncharacterized protein - -

Protein Sequence

MLAKFFPIILLVLSNVFMMFAWYGHLKFTDKPLYAVIFFSWMIALAEYCLAVPANRLGHQYYSAAELKTIQEVITLCVFMVFSVMYLGEGVTLNHLVGFGFIAVGAFFIFKGPF

Flanking regions ( +/- flanking 50bp)

TATCAGCGTAAAATAGAAAGACGCGACTCTTCTCCTCTGACGGATCACCCATGCTGGCAAAGTTTTTTCCTATTATTCTTCTGGTTTTATCCAATGTTTTTATGATGTTTGCCTGGTACGGGCACCTGAAATTTACTGATAAACCGTTGTACGCTGTAATTTTTTTCAGTTGGATGATAGCGCTCGCCGAGTATTGCCTGGCAGTTCCGGCGAACCGGCTGGGGCATCAGTATTATAGTGCCGCTGAACTGAAAACAATTCAGGAAGTGATTACACTTTGCGTGTTTATGGTTTTCTCAGTGATGTATCTGGGAGAGGGAGTTACGCTCAATCACCTTGTCGGTTTTGGTTTTATTGCGGTGGGGGCATTCTTTATTTTTAAAGGGCCGTTTTAAACGTAACAGCACATCACACATTTATGATAACGGTACTGTGAATTTATCCA