Homologs in group_3037

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_16820 EHELCC_16820 100.0 Morganella morganii S2 fba class II fructose-1,6-bisphosphate aldolase
NLDBIP_17630 NLDBIP_17630 100.0 Morganella morganii S4 fba class II fructose-1,6-bisphosphate aldolase
LHKJJB_17550 LHKJJB_17550 100.0 Morganella morganii S3 fba class II fructose-1,6-bisphosphate aldolase
HKOGLL_17365 HKOGLL_17365 100.0 Morganella morganii S5 fba class II fructose-1,6-bisphosphate aldolase
F4V73_RS10325 F4V73_RS10325 92.7 Morganella psychrotolerans fba class II fructose-1,6-bisphosphate aldolase

Distribution of the homologs in the orthogroup group_3037

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3037

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P94453 7.5e-115 335 57 1 285 3 fba Fructose-bisphosphate aldolase Geobacillus stearothermophilus
P13243 3.52e-106 313 55 1 285 1 fbaA Probable fructose-bisphosphate aldolase Bacillus subtilis (strain 168)
Q8CNI3 1.51e-103 306 52 1 285 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM97 1.51e-103 306 52 1 285 3 fba Fructose-bisphosphate aldolase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P67478 9.22e-103 304 52 1 285 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MW2)
Q6G7I5 9.22e-103 304 52 1 285 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MSSA476)
Q6GEV0 9.22e-103 304 52 1 285 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain MRSA252)
P99075 9.22e-103 304 52 1 285 1 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain N315)
P67477 9.22e-103 304 52 1 285 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HE75 9.22e-103 304 52 1 285 3 fba Fructose-bisphosphate aldolase Staphylococcus aureus (strain COL)
A7ZAH2 1.16e-99 296 51 2 286 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P42420 4.11e-98 292 50 2 285 1 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus subtilis (strain 168)
Q65D09 1.44e-95 286 49 2 286 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9KAH3 1.67e-91 276 49 2 285 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5WKY5 6.94e-86 261 47 2 285 3 iolJ 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase Shouchella clausii (strain KSM-K16)
P75089 8.05e-75 233 43 5 291 3 fba Fructose-bisphosphate aldolase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47269 4.73e-74 231 42 5 291 3 fba Fructose-bisphosphate aldolase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P0CZ59 5.89e-74 231 44 7 296 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ58 5.89e-74 231 44 7 296 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P68906 7e-74 231 44 7 296 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M18 (strain MGAS8232)
P68905 7e-74 231 44 7 296 3 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M1
Q5XA12 1.18e-73 230 44 7 296 1 fba Fructose-bisphosphate aldolase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0A4S2 1.41e-72 228 42 6 294 1 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4S1 1.41e-72 228 42 6 294 3 fba Fructose-bisphosphate aldolase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q703I2 2.16e-67 214 41 6 311 1 fba Fructose-bisphosphate aldolase Thermus caldophilus
Q9PPP3 2.7e-67 214 40 5 285 3 fba Fructose-bisphosphate aldolase Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q7CPQ7 4.37e-66 211 39 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGZ9 4.37e-66 211 39 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella typhi
A9N6Z8 6.46e-66 210 39 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5BGG5 8.05e-65 207 39 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain AKU_12601)
Q5PL86 8.05e-65 207 39 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MPP7 3.23e-64 206 38 4 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WEV6 6.15e-64 205 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Enterobacter sp. (strain 638)
Q8VS16 1.33e-63 204 39 4 288 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella oxytoca
A6TEF4 1.36e-63 204 40 5 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7UJ37 1.97e-63 204 40 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q9KIP8 9.15e-63 202 39 6 288 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli
Q1R6K0 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain UTI89 / UPEC)
B6I1L2 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SE11)
P0AB74 2.01e-62 201 39 6 288 1 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12)
B1IRH9 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AB75 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCW8 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG46 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O1:K1 / APEC
A8A4V3 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O9:H4 (strain HS)
B1XGU9 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / DH10B)
C4ZR47 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain K12 / MC4100 / BW2952)
B7M045 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O8 (strain IAI1)
B7N0S6 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O81 (strain ED1a)
B5YS30 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AB76 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O157:H7
B7LH72 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain 55989 / EAEC)
B7MB62 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZS33 2.01e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LMU4 3.69e-62 201 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8AQ28 4.88e-62 200 38 5 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1LFP2 1.25e-61 199 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli (strain SMS-3-5 / SECEC)
B7NDC5 1.25e-61 199 39 6 288 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NKL0 2.45e-61 198 39 6 287 3 kbaY D-tagatose-1,6-bisphosphate aldolase subunit KbaY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B4TWB0 3.48e-61 198 38 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella schwarzengrund (strain CVM19633)
A8B2U2 3.91e-61 199 37 6 312 1 fba Fructose-bisphosphate aldolase Giardia intestinalis (strain ATCC 50803 / WB clone C6)
C0PZ24 4e-61 198 38 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella paratyphi C (strain RKS4594)
B4TIX9 4e-61 198 38 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella heidelberg (strain SL476)
B5REK6 4e-61 198 38 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZS8 4e-61 198 38 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella enteritidis PT4 (strain P125109)
B4T6B9 4.92e-61 197 38 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella newport (strain SL254)
Q57JK9 3.59e-60 196 38 4 288 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Salmonella choleraesuis (strain SC-B67)
Q83QY5 1.9e-57 188 36 3 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri
P0C8J6 2.31e-57 188 36 4 287 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12)
B1IYY4 2.31e-57 188 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A1W1 2.31e-57 188 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O9:H4 (strain HS)
B1X7I7 2.31e-57 188 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / DH10B)
C4ZSI0 2.31e-57 188 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain K12 / MC4100 / BW2952)
B2TY92 3.87e-57 187 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7M477 3.87e-57 187 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O8 (strain IAI1)
B7L9W7 4.65e-57 187 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain 55989 / EAEC)
Q0T342 6.72e-57 187 35 3 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella flexneri serotype 5b (strain 8401)
Q3Z0B4 7.09e-57 187 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella sonnei (strain Ss046)
B5YV43 7.81e-57 187 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4R2 7.81e-57 187 36 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O157:H7
B7NPN7 1.27e-56 186 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NCC6 2.11e-56 186 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0C8J7 2.35e-56 186 36 5 288 1 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli
Q323C6 2.48e-56 186 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella boydii serotype 4 (strain Sb227)
B1LN92 4.2e-56 185 37 4 263 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain SMS-3-5 / SECEC)
A7ZNR5 5.5e-56 185 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TFZ6 6.33e-56 184 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1R9X7 6.9e-56 184 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli (strain UTI89 / UPEC)
A1ACW2 6.9e-56 184 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O1:K1 / APEC
B7MEF1 6.9e-56 184 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O45:K1 (strain S88 / ExPEC)
Q9ZMQ6 7.12e-56 185 36 7 313 3 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain J99 / ATCC 700824)
B7UFB3 3.19e-55 183 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P56109 3.25e-55 183 35 7 313 1 fba Fructose-bisphosphate aldolase Helicobacter pylori (strain ATCC 700392 / 26695)
Q8FFY7 5.58e-55 182 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32EA9 8.13e-55 182 35 4 287 3 gatY D-tagatose-1,6-bisphosphate aldolase subunit GatY Shigella dysenteriae serotype 1 (strain Sd197)
P77704 6.88e-54 179 38 4 289 1 ydjI Uncharacterized protein YdjI Escherichia coli (strain K12)
A0A2P6MHY1 9.61e-49 166 33 5 291 1 sqiA Sulfofructosephosphate aldolase Alkalicoccus urumqiensis
O83668 2.47e-45 159 30 8 327 3 fba Fructose-bisphosphate aldolase Treponema pallidum (strain Nichols)
Q59100 4.22e-44 155 32 10 331 3 cbbAC Fructose-bisphosphate aldolase, chromosomal Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q59101 3.91e-43 153 32 10 331 3 cbbAP Fructose-bisphosphate aldolase, plasmid Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9I5Y1 7.39e-40 145 32 12 331 3 fba Fructose-bisphosphate aldolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8YNK2 4.2e-39 143 30 9 331 1 fda Fructose-bisphosphate aldolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O87796 1.04e-38 142 31 9 331 3 fba Fructose-bisphosphate aldolase Stutzerimonas stutzeri
Q9XDP3 3.09e-38 140 30 9 331 3 fba Fructose-bisphosphate aldolase Nostoc commune
Q55664 2.71e-37 138 30 10 333 1 fbaA Fructose-bisphosphate aldolase class 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q56815 2.96e-37 138 30 11 334 1 cbbA Fructose-bisphosphate aldolase Xanthobacter flavus
P56888 1.04e-34 131 29 10 336 3 cbbA Fructose-bisphosphate aldolase Sinorhizobium medicae (strain WSM419)
P58336 5.29e-34 129 28 9 332 3 cbbA Fructose-bisphosphate aldolase Rhizobium meliloti (strain 1021)
P29271 2.17e-32 125 28 10 335 3 cfxB Fructose-bisphosphate aldolase 2 Cereibacter sphaeroides
P0CJ44 1.55e-31 122 31 10 292 1 CIMG_05755 Putative fructose-bisphosphate aldolase Coccidioides immitis (strain RS)
P27995 1.32e-30 120 29 12 336 3 cfxA Fructose-bisphosphate aldolase 1 Cereibacter sphaeroides
D4GYE0 1.2e-27 112 28 7 294 1 fba Fructose-bisphosphate aldolase class 2 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O69600 7.88e-22 96 28 10 332 3 fba Fructose-bisphosphate aldolase Mycobacterium leprae (strain TN)
P19537 1.19e-21 96 28 10 331 1 fba Fructose-bisphosphate aldolase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q0PAS0 1.29e-20 93 27 7 281 1 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1VYV7 1.41e-20 93 27 7 281 3 fba Fructose-bisphosphate aldolase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P9WQA3 1.68e-20 92 29 11 332 1 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQA2 1.68e-20 92 29 11 332 3 fba Fructose-bisphosphate aldolase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67476 1.68e-20 92 29 11 332 3 fba Fructose-bisphosphate aldolase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9ZEM7 3.53e-19 89 29 9 276 1 fba Fructose-bisphosphate aldolase Streptomyces galbus
P36580 1.24e-18 87 31 9 245 1 fba1 Fructose-bisphosphate aldolase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9URB4 3.28e-18 86 26 12 346 1 FBA1 Fructose-bisphosphate aldolase Candida albicans (strain SC5314 / ATCC MYA-2876)
P57526 4.71e-18 86 24 9 333 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P44429 6.13e-18 85 26 10 281 3 fba Fructose-bisphosphate aldolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P53444 7.65e-18 85 26 13 341 3 fba Fructose-bisphosphate aldolase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q9X8R6 8.23e-18 85 28 11 334 3 fba Fructose-bisphosphate aldolase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q89AB6 9.21e-17 82 24 9 333 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P0AB73 5.37e-16 80 27 9 284 3 fbaA Fructose-bisphosphate aldolase class 2 Shigella flexneri
P0AB71 5.37e-16 80 27 9 284 1 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli (strain K12)
P0AB72 5.37e-16 80 27 9 284 3 fbaA Fructose-bisphosphate aldolase class 2 Escherichia coli O157:H7
O52402 7.19e-16 80 26 10 282 3 fba Fructose-bisphosphate aldolase Edwardsiella ictaluri (strain 93-146)
Q9HGY9 1.88e-15 79 25 10 338 2 fbaA Fructose-bisphosphate aldolase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
O51401 3.83e-15 78 27 10 271 1 fba Fructose-bisphosphate aldolase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q96UH7 1.22e-14 76 24 9 341 1 FBA1 Fructose-bisphosphate aldolase 1 Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)
Q8K9B2 1.33e-14 76 23 10 328 3 fbaA Fructose-bisphosphate aldolase class 2 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9C2U0 3.6e-14 75 23 8 337 3 FBA1 Fructose-bisphosphate aldolase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P14540 3.9e-12 69 23 10 333 1 FBA1 Fructose-bisphosphate aldolase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8J0N6 1.07e-06 52 23 11 319 2 FBA2 Fructose-bisphosphate aldolase 2 Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_18120
Feature type CDS
Gene fba
Product class II fructose-1,6-bisphosphate aldolase
Location 25750 - 26613 (strand: 1)
Length 864 (nucleotides) / 287 (amino acids)

Contig

Accession contig_32
Length 35210 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3037
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01116 Fructose-bisphosphate aldolase class-II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0191 Carbohydrate transport and metabolism (G) G Fructose/tagatose bisphosphate aldolase

Kegg Ortholog Annotation(s)

Protein Sequence

MLVSMENMLNRAFARQYAVGQFNINNLEWTGTVLKVAQQLRSPVILGVSGGTIKHMLGLKCIHDIVVNAMEFMEIDVPVALHLDHGQSYEACEAAIKAGFSSVMFDGSHMPFAENLAITKRLVTYAHRRGVSVEAELGTIAGSEDGIVNSHVIYADPAECQKLVEETGVDCLAAALGSTHGLYKGKAKLGFAEMQHIAQLVKVPLVLHGGTGISDEDMKKAISLGTAKINVNTENMYAWCLSVKEQFEQQGAHDINDPRKVIMKGLQPVAERVEERMRLFGSAGQSL

Flanking regions ( +/- flanking 50bp)

ATTCTGGTTTTTGATTAAATTCCAGTTATACGCCAACAAGGGGAAATCCGATGTTAGTTTCGATGGAGAATATGCTCAATCGTGCCTTTGCACGCCAGTACGCCGTCGGCCAGTTTAATATTAATAACCTGGAGTGGACCGGAACGGTATTAAAAGTTGCACAGCAACTGCGTTCCCCGGTTATTTTAGGTGTCTCCGGCGGAACCATAAAACATATGCTCGGGCTCAAATGTATTCACGATATTGTGGTGAATGCGATGGAGTTTATGGAAATAGATGTGCCGGTGGCACTGCATCTGGATCACGGCCAGTCTTATGAAGCCTGTGAGGCGGCAATTAAAGCCGGTTTCAGCTCCGTGATGTTCGACGGTTCACATATGCCGTTTGCCGAAAACCTGGCAATCACCAAACGTCTGGTGACTTACGCGCACCGCCGTGGTGTGTCTGTGGAAGCAGAGCTGGGTACCATCGCGGGCAGTGAGGACGGAATTGTGAATTCTCACGTAATTTATGCGGACCCGGCAGAGTGTCAGAAGCTGGTGGAAGAAACCGGGGTGGATTGTCTGGCGGCGGCGCTCGGCTCGACTCACGGGCTGTACAAAGGCAAGGCGAAGCTCGGTTTTGCGGAAATGCAGCATATCGCGCAACTGGTGAAAGTGCCGCTGGTACTGCACGGCGGAACTGGTATTTCAGACGAGGACATGAAGAAAGCGATTTCACTCGGTACGGCGAAAATCAACGTTAATACGGAAAATATGTATGCGTGGTGCCTGTCCGTGAAAGAGCAGTTTGAACAGCAGGGCGCGCATGATATCAACGATCCGCGCAAAGTGATTATGAAAGGATTGCAGCCGGTCGCGGAGCGGGTGGAAGAACGGATGCGTCTGTTCGGCTCAGCCGGGCAGTCTCTGTAACCCTGTCAGATCCTGCGGTGGCCGCCGCTCAGGCGGTCACCGGGGATTGG