Homologs in group_2199

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16640 FBDBKF_16640 98.8 Morganella morganii S1 - Putative DNA-binding transcriptional regulator
EHELCC_16695 EHELCC_16695 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_17755 NLDBIP_17755 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_17675 LHKJJB_17675 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_17490 HKOGLL_17490 100.0 Morganella morganii S5 - hypothetical protein
PMI_RS17360 PMI_RS17360 23.6 Proteus mirabilis HI4320 - WYL domain-containing protein

Distribution of the homologs in the orthogroup group_2199

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2199

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52133 1.09e-09 55 36 1 79 4 yfjR Uncharacterized HTH-type transcriptional regulator YfjR Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17995
Feature type CDS
Gene -
Product hypothetical protein
Location 126 - 395 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession contig_32
Length 35210 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2199
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF13280 WYL domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2378 Transcription (K) K Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains

Protein Sequence

MLSFRCDGQDYEGMAPYKLIYFQRDWYLCGEWQSALRVFRFSQLQNIAVSGRRFRQDAVIARTVTRPEFITALPHYQFIRSLITQRNIV

Flanking regions ( +/- flanking 50bp)

TATCCACCTTAACTTAATGATTTTTACCAAAATCATTAGGGGATTCATCAGTGCTCAGCTTCCGCTGTGACGGTCAGGACTATGAGGGGATGGCTCCCTACAAGCTGATTTATTTTCAGCGGGACTGGTATCTGTGCGGGGAATGGCAGTCAGCCCTGCGGGTGTTCCGGTTCAGTCAGCTGCAGAACATTGCCGTGTCCGGACGCCGTTTCCGGCAGGATGCGGTTATCGCACGGACAGTCACCCGGCCCGAATTCATCACCGCATTACCCCATTATCAGTTTATCCGTTCATTAATCACCCAGAGGAACATCGTATGATAAAAGCCCGCCTCACCGCCGTCCTGCTGTCGGCCCTGCTGCTGGGAGCC