Homologs in group_2255

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17270 EHELCC_17270 100.0 Morganella morganii S2 ribE 6,7-dimethyl-8-ribityllumazine synthase
NLDBIP_17925 NLDBIP_17925 100.0 Morganella morganii S4 ribE 6,7-dimethyl-8-ribityllumazine synthase
LHKJJB_17845 LHKJJB_17845 100.0 Morganella morganii S3 ribE 6,7-dimethyl-8-ribityllumazine synthase
HKOGLL_17855 HKOGLL_17855 100.0 Morganella morganii S5 ribE 6,7-dimethyl-8-ribityllumazine synthase
F4V73_RS16550 F4V73_RS16550 96.8 Morganella psychrotolerans ribE 6,7-dimethyl-8-ribityllumazine synthase
PMI_RS00395 PMI_RS00395 88.5 Proteus mirabilis HI4320 ribE 6,7-dimethyl-8-ribityllumazine synthase

Distribution of the homologs in the orthogroup group_2255

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2255

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EU19 3.72e-98 282 88 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Proteus mirabilis (strain HI4320)
Q7N0I9 5.6e-96 276 86 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JIE2 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DV8 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPG7 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis (strain Pestoides F)
Q1CL92 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2J8 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC41 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis
B2K6T3 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4I4 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLE8 5.08e-93 269 83 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JNS3 9.94e-92 266 82 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NV98 9.42e-90 261 80 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sodalis glossinidius (strain morsitans)
A8GAN7 1.58e-89 260 80 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Serratia proteamaculans (strain 568)
Q6D848 2.73e-89 259 81 1 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BCH5 4.88e-89 259 77 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Edwardsiella ictaluri (strain 93-146)
C6DB33 8.84e-89 258 80 1 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MFG5 7.09e-87 253 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cronobacter sakazakii (strain ATCC BAA-894)
B2VHS9 1.88e-86 252 77 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4W787 6.22e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Enterobacter sp. (strain 638)
P66038 6.29e-86 251 78 0 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66039 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella typhi
B4TM97 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella schwarzengrund (strain CVM19633)
B5BDB5 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella paratyphi A (strain AKU_12601)
C0Q7U2 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella paratyphi C (strain RKS4594)
Q5PFS8 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SWQ9 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella newport (strain SL254)
B5R6R8 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTG5 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella enteritidis PT4 (strain P125109)
B5FKS2 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella dublin (strain CT_02021853)
Q57SE7 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella choleraesuis (strain SC-B67)
B5EXF8 6.29e-86 251 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella agona (strain SL483)
B4T8Q8 1.82e-85 250 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella heidelberg (strain SL476)
Q3Z4Z4 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella sonnei (strain Ss046)
P61718 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella flexneri
Q32JG9 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q325I6 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella boydii serotype 4 (strain Sb227)
B2U4L8 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6T5E8 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y0X6 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Klebsiella pneumoniae (strain 342)
B7LMH2 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LJG5 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6HZL6 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain SE11)
B7N8W7 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P61714 2.56e-85 249 78 0 155 1 ribE 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain K12)
B1J034 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P61715 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKM6 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZX67 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O9:H4 (strain HS)
B1XF03 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain K12 / DH10B)
C4ZTH2 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M3Q4 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O8 (strain IAI1)
B7MQD0 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O81 (strain ED1a)
B7NJ82 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z3R9 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P61717 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O157:H7
B7L649 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain 55989 / EAEC)
B7UJN8 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIG8 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AK39 2.56e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7MD73 3.84e-85 249 78 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
A6VPE9 3.12e-82 242 73 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0UU22 3.51e-81 239 74 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Histophilus somni (strain 2336)
Q0I3N6 3.51e-81 239 74 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Histophilus somni (strain 129Pt)
A5UF15 4.94e-81 239 73 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain PittGG)
A5UCB8 4.94e-81 239 73 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain PittEE)
Q4QKN2 4.94e-81 239 73 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain 86-028NP)
P45149 2.76e-80 237 72 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57869 8.17e-80 236 72 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pasteurella multocida (strain Pm70)
Q65TX7 6.76e-77 228 69 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C4LAE1 6.82e-75 223 68 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q6LU12 1.45e-73 220 66 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photobacterium profundum (strain SS9)
B6EI99 7.02e-73 218 67 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio salmonicida (strain LFI1238)
Q8G9G4 2.92e-72 216 66 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio fischeri
B5FBF8 2.92e-72 216 66 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio fischeri (strain MJ11)
Q5E6Z8 2.92e-72 216 66 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q93E92 4.01e-72 216 65 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photobacterium leiognathi
Q87RU4 3.78e-70 211 65 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWU0 3.78e-70 211 65 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio campbellii (strain ATCC BAA-1116)
Q086C4 4.17e-70 211 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella frigidimarina (strain NCIMB 400)
A1SUU5 4.71e-70 211 64 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A8H1Q5 8.5e-70 210 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q494E6 8.21e-69 208 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Blochmanniella pennsylvanica (strain BPEN)
B0TJZ0 1.4e-68 207 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella halifaxensis (strain HAW-EB4)
Q12Q43 2.74e-68 206 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q485J2 3.19e-68 206 64 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0HXJ1 4.11e-68 206 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sp. (strain MR-7)
Q0HL88 4.11e-68 206 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sp. (strain MR-4)
Q8EBP3 4.11e-68 206 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8FSR4 5.34e-68 206 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sediminis (strain HAW-EB3)
Q15W98 8.65e-68 205 60 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P51963 1.03e-67 205 62 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photobacterium phosphoreum
A9KYJ1 1.19e-67 205 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS195)
A6WR47 1.19e-67 205 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS185)
A3D7C5 1.19e-67 205 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6W6 1.19e-67 205 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS223)
A1RHD5 1.69e-67 204 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sp. (strain W3-18-1)
A4Y961 1.69e-67 204 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q7MN53 1.84e-67 204 64 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio vulnificus (strain YJ016)
Q8DF99 1.84e-67 204 64 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio vulnificus (strain CMCP6)
B8CJN2 2.24e-67 204 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
B1KJK4 4.18e-67 204 59 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A1S4C0 4.28e-67 204 60 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9KPU4 1.06e-66 202 63 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A3QC62 1.54e-66 202 58 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5QVF0 1.05e-65 200 59 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3II28 6.79e-64 195 62 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudoalteromonas translucida (strain TAC 125)
Q7VM44 1.4e-63 194 61 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8D7Y8 2.3e-62 192 56 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9N6 2.3e-62 192 56 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q9ZNM0 3.97e-62 191 56 0 155 2 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B3H0P9 5.72e-62 190 60 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q8K9A6 2.1e-61 189 54 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q21F19 3.52e-61 188 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B0BTN9 3.72e-61 188 59 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
P50856 6.29e-61 188 59 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae
B8F5Z8 6.79e-61 187 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q01994 6.83e-61 187 62 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase (Fragment) Photobacterium leiognathi
Q88QH6 3.86e-60 186 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KL70 3.86e-60 186 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas putida (strain GB-1)
A5VXW0 3.86e-60 186 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFM0 3.86e-60 186 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas entomophila (strain L48)
A4VHT4 6.96e-60 185 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Stutzerimonas stutzeri (strain A1501)
Q0ABQ4 1.23e-59 184 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A3MZA3 1.91e-59 184 58 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q6F6V3 6.79e-59 182 61 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C4Z8N0 6.87e-59 182 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q31FT1 8.66e-59 182 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9HWX5 1.07e-58 182 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02SM0 1.07e-58 182 56 1 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7Q5 1.07e-58 182 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain LESB58)
A6V049 1.07e-58 182 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain PA7)
A4XZ35 2.26e-58 181 54 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas mendocina (strain ymp)
A4IQG7 2.98e-58 181 56 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacillus thermodenitrificans (strain NG80-2)
Q8RIR4 5.15e-58 180 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
C1DLH8 5.98e-58 180 53 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A8FER2 6.69e-58 180 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus pumilus (strain SAFR-032)
A1WVG1 8.41e-58 180 54 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Halorhodospira halophila (strain DSM 244 / SL1)
B0V9X5 8.41e-58 180 57 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain AYE)
A3MA34 8.41e-58 180 57 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VPU0 8.41e-58 180 57 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain SDF)
B2I1Q0 8.41e-58 180 57 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain ACICU)
B7I251 8.41e-58 180 57 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain AB0057)
B7GUW3 8.41e-58 180 57 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain AB307-0294)
Q889Q6 1e-57 180 54 1 155 3 ribH1 6,7-dimethyl-8-ribityllumazine synthase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1IL45 1.79e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Okra / Type B1)
A2RLD8 2e-57 179 56 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lactococcus lactis subsp. cremoris (strain MG1363)
B1KZ46 2e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Loch Maree / Type A3)
A7GH84 2e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C1FV67 2e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Kyoto / Type A2)
A5I5U9 2e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXC4 2e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain ATCC 19397 / Type A)
Q897Q7 2.02e-57 179 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium tetani (strain Massachusetts / E88)
Q89AB1 2.1e-57 179 52 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B9M1E6 2.35e-57 179 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A0Q3H6 2.72e-57 179 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium novyi (strain NT)
A6TM20 2.72e-57 179 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Alkaliphilus metalliredigens (strain QYMF)
B9MPC6 2.99e-57 179 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q9CGU6 3.06e-57 178 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lactococcus lactis subsp. lactis (strain IL1403)
B5ELV8 3.06e-57 178 55 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J444 3.06e-57 178 55 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B3E758 3.3e-57 178 57 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B1H0H9 3.35e-57 178 52 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Endomicrobium trichonymphae
B0K0Z0 3.81e-57 178 53 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermoanaerobacter sp. (strain X514)
B2VAC3 3.81e-57 178 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurihydrogenibium sp. (strain YO3AOP1)
B7GKI1 4.59e-57 178 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q7VRI2 7.07e-57 177 53 1 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Blochmanniella floridana
C3L2U0 7.51e-57 177 53 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain 657 / Type Ba4)
A5G3J9 1.56e-56 177 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geotalea uraniireducens (strain Rf4)
B0KAI3 1.58e-56 177 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q5KXK7 1.84e-56 176 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacillus kaustophilus (strain HTA426)
C0QVI8 2.34e-56 176 56 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A1ANJ6 2.61e-56 176 55 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B8FJ77 4.32e-56 176 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfatibacillum aliphaticivorans
B2V4J4 4.67e-56 175 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Alaska E43 / Type E3)
C5D3M9 5.74e-56 175 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacillus sp. (strain WCH70)
A4XHM5 6.83e-56 175 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q0TTN7 8.9e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
C1CP44 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CI69 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain P1031)
C1CBX9 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain JJA)
P66041 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS11 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain CGSP14)
P66040 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKD0 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8F3 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain Hungary19A-6)
C1CAI5 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain 70585)
B5E6C6 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae serotype 19F (strain G54)
Q04MR3 9.59e-56 175 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2S9R9 1.58e-55 174 58 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Hahella chejuensis (strain KCTC 2396)
B2TJ82 1.59e-55 174 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Eklund 17B / Type B)
C0QT44 2.35e-55 174 53 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Persephonella marina (strain DSM 14350 / EX-H1)
P11998 2.43e-55 174 53 1 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus subtilis (strain 168)
C5BS85 2.51e-55 174 53 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3Z799 2.74e-55 174 55 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
A9B4R4 3.2e-55 173 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A5MZ82 4.25e-55 173 53 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E377 4.25e-55 173 53 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium kluyveri (strain NBRC 12016)
Q3B1F0 4.48e-55 173 54 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A1VEL0 4.83e-55 173 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratidesulfovibrio vulgaris (strain DP4)
P61940 4.83e-55 173 54 1 154 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q0SVI9 6.45e-55 172 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium perfringens (strain SM101 / Type A)
Q8XMW9 6.45e-55 172 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium perfringens (strain 13 / Type A)
Q8ELL1 8.77e-55 172 56 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6AP94 9.12e-55 172 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A4J6A4 1.08e-54 172 54 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q3AUB5 1.29e-54 172 52 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium chlorochromatii (strain CaD3)
B5E854 1.31e-54 172 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q3ZY85 1.53e-54 172 54 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Dehalococcoides mccartyi (strain CBDB1)
A5FQE3 1.53e-54 172 54 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A1BJF9 1.78e-54 171 54 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q97LG8 2.47e-54 171 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8D291 3.25e-54 171 50 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Wigglesworthia glossinidia brevipalpis
B4SGD1 3.43e-54 171 53 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q24WY8 3.47e-54 171 53 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfitobacterium hafniense (strain Y51)
B8FXB6 3.47e-54 171 53 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A4SGN3 3.54e-54 171 52 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
P61597 4.66e-54 170 57 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain MW2)
P0C600 4.66e-54 170 57 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus
Q6G8G2 4.66e-54 170 57 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain MSSA476)
P99141 4.66e-54 170 57 1 142 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain N315)
P61595 4.66e-54 170 57 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ITT7 4.66e-54 170 57 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain JH9)
A6U2N1 4.66e-54 170 57 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain JH1)
A7X3K7 4.66e-54 170 57 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8J193 5.07e-54 170 54 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q2LQN1 6.83e-54 170 53 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Syntrophus aciditrophicus (strain SB)
A8Z4J3 7.46e-54 170 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain USA300 / TCH1516)
A6QHU9 7.46e-54 170 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain Newman)
Q5HF08 7.46e-54 170 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain COL)
Q2YTM0 7.46e-54 170 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FXG2 7.46e-54 170 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFX3 7.46e-54 170 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain USA300)
Q6GFT6 8.59e-54 170 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain MRSA252)
A6LSS9 1.11e-53 169 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A7Z674 1.33e-53 169 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q4L7B0 1.47e-53 169 58 1 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus haemolyticus (strain JCSC1435)
Q3A4L3 1.5e-53 169 52 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q44681 1.85e-53 169 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus amyloliquefaciens
A9VG51 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus mycoides (strain KBAB4)
Q6HE53 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635G9 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain ZK / E33L)
C1EQY6 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain 03BB102)
B7JLW7 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain AH820)
Q81MB5 3.03e-53 168 52 1 150 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus anthracis
A0RIB4 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus thuringiensis (strain Al Hakam)
C3LIX8 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7P8 3.03e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus anthracis (strain A0248)
A0LI20 3.19e-53 168 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2RK04 3.4e-53 168 52 2 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B3EHV0 3.71e-53 168 53 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
P61719 3.72e-53 168 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A2SQG5 4.14e-53 168 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
C6E3M5 4.14e-53 168 53 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacter sp. (strain M21)
Q39V66 7.98e-53 167 52 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B7HAY5 8.83e-53 167 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain B4264)
B9LIH3 9.72e-53 167 51 1 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WFR1 9.72e-53 167 51 1 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B8I3K7 9.93e-53 167 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A3DBL9 1.08e-52 167 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q818X5 1.14e-52 167 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7IWM6 1.14e-52 167 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain G9842)
Q9KCL4 1.42e-52 167 54 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B7GN04 1.68e-52 166 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
C4XHY9 2e-52 166 52 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q5WH07 2.11e-52 166 53 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shouchella clausii (strain KSM-K16)
A5D1C7 2.43e-52 166 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C0QKW7 2.68e-52 166 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B5YHQ1 2.84e-52 166 49 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
B3QL67 3.53e-52 166 50 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q3AC30 3.74e-52 166 53 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B9IWX5 5.73e-52 165 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain Q1)
B7HNM9 5.73e-52 165 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain AH187)
Q30YL2 5.83e-52 165 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8CNU3 7.2e-52 165 57 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNE4 7.2e-52 165 57 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B1YEJ3 8.98e-52 164 50 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B8DJF2 1.28e-51 164 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8E0I2 2.55e-51 164 51 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E657 2.55e-51 164 51 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1V6 2.55e-51 164 51 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q49YJ6 3.22e-51 163 55 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1CVF3 4.12e-51 163 49 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain HPAG1)
B4S3W8 6.32e-51 162 48 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q8KAW4 6.6e-51 162 50 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B1I2D4 8.09e-51 162 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulforudis audaxviator (strain MP104C)
A8ZTU7 8.94e-51 162 53 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q01T71 9.12e-51 162 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Solibacter usitatus (strain Ellin6076)
C5CJ15 9.56e-51 162 50 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A7H4Z4 1.09e-50 162 52 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q9ZN56 1.33e-50 162 50 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain J99 / ATCC 700824)
C6BYC7 1.36e-50 162 48 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q1MS15 1.41e-50 162 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lawsonia intracellularis (strain PHE/MN1-00)
Q17Z25 1.42e-50 162 49 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter acinonychis (strain Sheeba)
Q5HW84 1.75e-50 161 52 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni (strain RM1221)
A1VYA3 1.75e-50 161 52 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PIB9 1.75e-50 161 52 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FKH0 1.75e-50 161 52 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B3EL33 1.78e-50 161 48 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium phaeobacteroides (strain BS1)
B9KFN9 1.94e-50 161 50 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
P61723 2.35e-50 161 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B9DN29 3.77e-50 160 60 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus carnosus (strain TM300)
B3QWR1 4.52e-50 160 49 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q6MCT6 4.63e-50 161 49 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Protochlamydia amoebophila (strain UWE25)
Q054N5 5.96e-50 160 52 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04Q79 5.96e-50 160 52 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B5Z6D8 7.46e-50 160 49 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain G27)
O24854 2.86e-49 158 48 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
A0L3Z9 2.89e-49 158 47 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B6JPA1 3.52e-49 158 48 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain P12)
Q8F8T9 3.71e-49 158 52 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
B9L729 3.94e-49 158 51 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
P61724 7.14e-49 157 52 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A7HZG0 2.2e-48 156 50 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B9E7J1 2.31e-48 156 55 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Macrococcus caseolyticus (strain JCSC5402)
B2UW06 3.85e-48 155 48 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain Shi470)
Q5SLF7 5.21e-48 155 50 1 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P61728 5.21e-48 155 50 1 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
O68250 6.08e-48 155 50 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurospirillum multivorans
Q88X16 1.18e-47 154 47 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B9K7K0 2.31e-47 154 49 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q30TJ8 2.7e-47 153 50 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7VK54 6.5e-47 152 50 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A7ZBS6 7.41e-47 152 49 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter concisus (strain 13826)
B4UIM2 1.18e-46 152 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter sp. (strain K)
B8JEW4 1.18e-46 152 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A0RQJ7 1.25e-46 152 48 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter fetus subsp. fetus (strain 82-40)
B1LAJ8 1.65e-46 152 49 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga sp. (strain RQ2)
Q9X2E5 1.65e-46 152 49 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O66529 3.75e-46 150 46 1 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Aquifex aeolicus (strain VF5)
Q1J1M8 3.91e-46 150 47 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q65HW7 4.81e-46 150 53 1 132 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q7MAF0 4.95e-46 150 49 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A5ILQ1 6.96e-46 150 49 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q8GLK5 1.08e-45 149 47 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aquifex pyrophilus
A6QBK7 1.43e-45 149 48 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurovum sp. (strain NBC37-1)
A8EVW3 2.55e-45 148 48 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliarcobacter butzleri (strain RM4018)
Q5JD31 3.86e-45 148 45 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A7GWZ6 4.07e-45 148 48 2 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter curvus (strain 525.92)
P73527 8.86e-45 147 44 3 159 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B0ST02 1.6e-44 146 50 4 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SB77 1.6e-44 146 50 4 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q9XH32 8.89e-44 146 47 1 146 1 None 6,7-dimethyl-8-ribityllumazine synthase, chloroplastic Spinacia oleracea
A9BD87 1.01e-43 144 48 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9211)
A7HDY3 1.16e-43 144 48 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter sp. (strain Fw109-5)
Q1D349 2.67e-43 144 52 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Myxococcus xanthus (strain DK1622)
A6Q4R0 3.04e-43 143 46 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratiruptor sp. (strain SB155-2)
Q03D86 3.3e-43 143 46 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q5N0X6 3.87e-43 144 45 3 159 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31KZ5 3.87e-43 144 45 3 159 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q3MCG0 1.05e-42 143 46 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q03XY9 1.25e-42 141 42 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A5GQ24 1.61e-42 141 45 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain RCC307)
Q8YQ43 1.69e-42 142 46 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B6YUQ8 1.18e-41 139 44 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermococcus onnurineus (strain NA1)
B1XLJ1 1.53e-41 139 48 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q3B0Q0 2.07e-41 139 47 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain CC9902)
A5GHU9 2.1e-41 139 45 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain WH7803)
C1CYL1 2.74e-41 138 44 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A2C5A7 2.97e-41 138 47 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain NATL1A)
Q46IE7 4.54e-41 137 45 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain NATL2A)
Q317Z9 5.83e-41 137 46 2 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9312)
Q8DMP4 1.1e-40 137 43 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3ANH6 1.14e-40 137 44 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain CC9605)
A3PFD1 1.2e-40 136 46 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9301)
Q0IE03 1.33e-40 136 45 2 146 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain CC9311)
Q7V9M7 1.34e-40 136 45 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
C5A697 1.37e-40 136 42 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q9RXZ8 1.54e-40 136 41 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A2BTM4 1.59e-40 136 46 2 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain AS9601)
Q7UZL7 2e-40 136 43 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A8G7E8 3.8e-40 135 43 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9215)
O80575 4.04e-40 137 41 1 151 1 At2g44050 6,7-dimethyl-8-ribityllumazine synthase, chloroplastic Arabidopsis thaliana
A2BZ29 5.05e-40 135 44 2 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9515)
Q7V977 5.16e-40 135 44 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9313)
Q2S3N1 5.36e-40 135 45 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salinibacter ruber (strain DSM 13855 / M31)
A2C5T7 1.13e-39 134 44 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9303)
Q7UA19 1.63e-39 134 45 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Parasynechococcus marenigrum (strain WH8102)
Q7NLS9 2.22e-39 134 44 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q2ILH7 1.17e-38 132 47 1 132 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q83DP8 1.3e-38 131 45 1 142 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NCD4 1.3e-38 131 45 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J134 1.3e-38 131 45 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain CbuG_Q212)
B2JED1 2.45e-38 131 49 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B1MYJ5 2.91e-38 130 44 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leuconostoc citreum (strain KM20)
B6J943 5.83e-38 129 45 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain CbuK_Q154)
A9KC67 7.73e-38 129 45 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain Dugway 5J108-111)
B1WW99 8.74e-38 130 45 2 146 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A9AF24 1.38e-36 127 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia multivorans (strain ATCC 17616 / 249)
Q8U4L8 1.4e-36 126 40 3 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B2G7B1 1.98e-36 125 40 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJX0 1.98e-36 125 40 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Limosilactobacillus reuteri (strain DSM 20016)
A1AWF3 2.09e-36 126 42 2 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ruthia magnifica subsp. Calyptogena magnifica
A4JC82 2.09e-36 126 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BHJ7 2.22e-36 126 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q7MUR5 4.05e-36 125 48 1 134 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q03PZ7 4.39e-36 125 44 1 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B2RJ75 5.21e-36 125 48 1 134 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q1BYB6 6.15e-36 125 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia orbicola (strain AU 1054)
B1JX76 6.15e-36 125 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia orbicola (strain MC0-3)
B4EBT8 6.15e-36 125 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K5D2 6.15e-36 125 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia cenocepacia (strain HI2424)
A6L8H3 8.43e-36 124 44 1 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q9PES4 8.91e-36 124 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain 9a5c)
B1YUJ2 1.03e-35 124 46 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia ambifaria (strain MC40-6)
Q87AS7 1.32e-35 124 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U4K3 1.32e-35 124 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain M12)
B2I8Q5 1.32e-35 124 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain M23)
B2SNW4 1.44e-35 123 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZ91 1.44e-35 123 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q13V36 1.87e-35 124 46 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paraburkholderia xenovorans (strain LB400)
B2T6D0 1.87e-35 124 46 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B0JLM0 2.07e-35 124 41 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q9A9S4 2.18e-35 123 46 2 143 3 ribH1 6,7-dimethyl-8-ribityllumazine synthase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7NVF3 6.57e-35 122 42 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1H425 1.54e-34 120 46 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q63RP5 1.91e-34 121 47 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia pseudomallei (strain K96243)
A3NCF9 1.91e-34 121 47 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia pseudomallei (strain 668)
A3NY88 1.91e-34 121 47 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia pseudomallei (strain 1106a)
A1V1K5 1.91e-34 121 47 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain SAVP1)
Q62HV4 1.91e-34 121 47 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain ATCC 23344)
A2S9D4 1.91e-34 121 47 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain NCTC 10229)
A3MMR3 1.91e-34 121 47 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain NCTC 10247)
A1K280 2.19e-34 120 40 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Azoarcus sp. (strain BH72)
Q5P3H3 3.16e-34 120 43 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2FNL3 3.18e-34 120 42 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Stenotrophomonas maltophilia (strain K279a)
Q3BXI0 3.88e-34 120 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PPD6 3.88e-34 120 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas axonopodis pv. citri (strain 306)
A6WCA2 5.4e-34 120 44 3 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q8PCM7 8.04e-34 119 41 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVD2 8.04e-34 119 41 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UQU3 8.04e-34 119 41 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas campestris pv. campestris (strain 8004)
B4SJC0 1.38e-33 118 42 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Stenotrophomonas maltophilia (strain R551-3)
A1KSU7 3.21e-33 117 45 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A5CWS3 7.85e-33 117 43 3 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B4RJT4 1.19e-32 116 44 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria gonorrhoeae (strain NCCP11945)
Q5F9X9 1.19e-32 116 44 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P66037 1.22e-32 116 45 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66036 1.22e-32 116 45 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2W8 1.22e-32 116 45 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup C (strain 053442)
Q8Y1H8 6.53e-32 114 42 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C1A8F6 9.65e-32 114 44 2 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A6L3K7 1.15e-31 114 37 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q821P5 2.02e-31 113 38 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q3SGU9 2.08e-31 113 39 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thiobacillus denitrificans (strain ATCC 25259)
A5V939 2.45e-31 112 44 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q474N4 2.63e-31 113 42 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1TPC1 2.68e-31 112 42 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paracidovorax citrulli (strain AAC00-1)
Q0K7T9 3.25e-31 113 41 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B1W4A5 3.52e-31 112 47 3 128 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q11NR0 4.18e-31 112 45 1 134 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q8FT58 4.27e-31 112 44 3 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B2U7F0 5.19e-31 112 42 3 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ralstonia pickettii (strain 12J)
O84737 5.85e-31 112 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BAI7 5.85e-31 112 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KKW2 5.85e-31 112 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B8V8 5.85e-31 112 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q89ZW8 1.25e-30 110 39 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P61720 1.47e-30 111 41 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q9PLJ4 2.1e-30 110 38 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia muridarum (strain MoPn / Nigg)
Q64XS0 3.86e-30 109 39 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacteroides fragilis (strain YCH46)
A1W9I3 4.81e-30 109 40 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidovorax sp. (strain JS42)
Q2YD51 5.44e-30 109 43 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8NQ53 6.43e-30 109 42 3 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEG8 6.43e-30 109 42 3 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium glutamicum (strain R)
B9MBL6 8.45e-30 108 40 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidovorax ebreus (strain TPSY)
C3PG33 1.31e-29 108 41 3 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q827L9 1.37e-29 108 41 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A2SK12 1.68e-29 108 41 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1LJV9 2.07e-29 108 38 2 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9EWJ9 2.75e-29 107 41 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q255Z6 2.97e-29 107 36 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia felis (strain Fe/C-56)
Q21V18 3.45e-29 107 43 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q5NQA8 3.97e-29 107 43 3 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5L4Z3 5.95e-29 107 34 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia abortus (strain DSM 27085 / S26/3)
C1DB32 6.12e-29 107 44 3 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Laribacter hongkongensis (strain HLHK9)
A9I6G5 1.07e-28 107 43 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1WS77 1.26e-28 105 41 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Verminephrobacter eiseniae (strain EF01-2)
Q129J1 1.34e-28 105 40 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q82S08 1.94e-28 105 42 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A9WR65 2.94e-28 105 42 3 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q7VTN4 6.51e-28 104 42 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W143 6.86e-28 104 42 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WNT3 6.86e-28 104 42 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q0AD61 1.16e-27 103 43 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A0LZH6 1.58e-27 103 39 2 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A1VRD9 2.31e-27 102 40 3 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Polaromonas naphthalenivorans (strain CJ2)
C4LIS3 3.36e-27 102 39 3 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B8H6T9 6.85e-27 101 44 3 128 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q1GNT5 9.6e-27 100 46 3 127 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q6A6Y6 9.7e-27 101 37 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
B1XYF6 9.97e-27 101 41 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B2GGU6 2.22e-26 100 44 3 134 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A4SVH2 3.31e-26 100 39 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q9UUB1 3.55e-26 100 39 1 141 1 rib4 6,7-dimethyl-8-ribityllumazine synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0JVK2 4.39e-26 99 44 4 128 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Arthrobacter sp. (strain FB24)
B1XTA7 6.7e-26 99 38 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A5FNH3 9.08e-26 99 36 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q2NAP7 1.31e-25 97 44 2 127 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Erythrobacter litoralis (strain HTCC2594)
A1R5R8 1.37e-25 98 42 3 128 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paenarthrobacter aurescens (strain TC1)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17375
Feature type CDS
Gene ribE
Product 6,7-dimethyl-8-ribityllumazine synthase
Location 6095 - 6565 (strand: -1)
Length 471 (nucleotides) / 156 (amino acids)

Contig

Accession contig_28
Length 42791 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2255
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00885 6,7-dimethyl-8-ribityllumazine synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0054 Coenzyme transport and metabolism (H) H 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)

Kegg Ortholog Annotation(s)

Protein Sequence

MNVIKGVVSAPGARIAIAIARFNNFINDSLLDGAVDALERIGQVSSENITTVWVPGAYELPLAVKTLADTGKYDAIIALGTVIRGGTAHFEYVSGECSSGLSAVAMNSSIPVTFGVLTTENIEQAIERAGTKAGNKGAEAAMTALEMINVIKAIKG

Flanking regions ( +/- flanking 50bp)

TGTGATAAAATCCGCGCCCCGCAGTATGAAACTCGTAAGAAGGAAAGGCTATGAACGTCATTAAAGGTGTTGTCAGTGCGCCGGGTGCGCGTATCGCCATCGCAATTGCCCGCTTTAACAACTTCATCAACGACAGCCTGTTAGACGGTGCGGTTGATGCGCTTGAGCGTATTGGCCAGGTCTCCTCTGAGAACATTACAACGGTCTGGGTGCCGGGTGCTTATGAACTGCCGCTGGCAGTGAAAACGCTGGCCGATACCGGAAAATATGACGCTATTATCGCGCTGGGTACTGTTATCCGCGGCGGCACCGCACATTTTGAATATGTGTCCGGTGAATGCAGCTCCGGGTTATCTGCCGTTGCGATGAACAGCTCGATTCCGGTTACTTTCGGGGTACTGACCACCGAAAATATTGAACAGGCCATTGAACGTGCGGGAACCAAAGCCGGTAACAAAGGGGCGGAAGCCGCGATGACCGCGCTGGAAATGATTAATGTAATTAAAGCCATCAAAGGCTGAATCCGGATTTTAGTAAGGGGATATGTGTGAAACCTGCAGCTCGTCGTCGT