Homologs in group_2291

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17375 FBDBKF_17375 88.5 Morganella morganii S1 ribE 6,7-dimethyl-8-ribityllumazine synthase
EHELCC_17270 EHELCC_17270 88.5 Morganella morganii S2 ribE 6,7-dimethyl-8-ribityllumazine synthase
NLDBIP_17925 NLDBIP_17925 88.5 Morganella morganii S4 ribE 6,7-dimethyl-8-ribityllumazine synthase
LHKJJB_17845 LHKJJB_17845 88.5 Morganella morganii S3 ribE 6,7-dimethyl-8-ribityllumazine synthase
HKOGLL_17855 HKOGLL_17855 88.5 Morganella morganii S5 ribE 6,7-dimethyl-8-ribityllumazine synthase
F4V73_RS16550 F4V73_RS16550 89.7 Morganella psychrotolerans ribE 6,7-dimethyl-8-ribityllumazine synthase

Distribution of the homologs in the orthogroup group_2291

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2291

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EU19 2.4e-110 313 100 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Proteus mirabilis (strain HI4320)
Q7N0I9 5.82e-100 286 91 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DB33 6.69e-95 274 87 1 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B1JIE2 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DV8 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPG7 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis (strain Pestoides F)
Q1CL92 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2J8 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC41 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis
B2K6T3 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4I4 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLE8 1.98e-94 273 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JNS3 2.21e-94 272 85 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D848 1.1e-93 271 86 1 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BCH5 8.61e-92 266 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Edwardsiella ictaluri (strain 93-146)
A7MFG5 9.51e-92 266 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cronobacter sakazakii (strain ATCC BAA-894)
A8GAN7 3.21e-91 265 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Serratia proteamaculans (strain 568)
Q2NV98 7.73e-91 263 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sodalis glossinidius (strain morsitans)
Q3Z4Z4 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella sonnei (strain Ss046)
P61718 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella flexneri
Q32JG9 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q325I6 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella boydii serotype 4 (strain Sb227)
B2U4L8 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6T5E8 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y0X6 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Klebsiella pneumoniae (strain 342)
B7LMH2 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LJG5 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6HZL6 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain SE11)
B7N8W7 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P61714 1.28e-89 260 83 0 155 1 ribE 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain K12)
B1J034 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P61715 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKM6 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZX67 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O9:H4 (strain HS)
B1XF03 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain K12 / DH10B)
C4ZTH2 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M3Q4 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O8 (strain IAI1)
B7MQD0 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O81 (strain ED1a)
B7NJ82 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z3R9 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P61717 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O157:H7
B7L649 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli (strain 55989 / EAEC)
B7UJN8 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIG8 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AK39 1.28e-89 260 83 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7MD73 1.68e-89 260 82 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
A4W787 2.05e-89 260 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Enterobacter sp. (strain 638)
B2VHS9 1.04e-87 256 80 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P66038 4.14e-87 254 81 0 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66039 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella typhi
B4TM97 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella schwarzengrund (strain CVM19633)
B5BDB5 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella paratyphi A (strain AKU_12601)
C0Q7U2 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella paratyphi C (strain RKS4594)
Q5PFS8 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SWQ9 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella newport (strain SL254)
B5R6R8 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTG5 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella enteritidis PT4 (strain P125109)
B5FKS2 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella dublin (strain CT_02021853)
Q57SE7 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella choleraesuis (strain SC-B67)
B5EXF8 4.14e-87 254 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella agona (strain SL483)
B4T8Q8 9.33e-87 253 81 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salmonella heidelberg (strain SL476)
A5UF15 9.97e-84 246 75 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain PittGG)
A5UCB8 9.97e-84 246 75 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain PittEE)
Q4QKN2 9.97e-84 246 75 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain 86-028NP)
B0UU22 3.33e-83 244 75 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Histophilus somni (strain 2336)
Q0I3N6 3.33e-83 244 75 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Histophilus somni (strain 129Pt)
P45149 5.76e-83 244 75 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57869 2.17e-81 239 74 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pasteurella multocida (strain Pm70)
Q65TX7 1.74e-79 235 71 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VPE9 4.14e-79 234 69 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q6LU12 1.61e-78 232 69 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photobacterium profundum (strain SS9)
C4LAE1 8.87e-75 223 66 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B6EI99 1.03e-73 220 66 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio salmonicida (strain LFI1238)
Q93E92 1.6e-73 220 67 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photobacterium leiognathi
Q8G9G4 3.48e-73 219 65 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio fischeri
B5FBF8 3.48e-73 219 65 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio fischeri (strain MJ11)
Q5E6Z8 3.48e-73 219 65 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1SUU5 1.09e-72 218 65 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
P51963 3.25e-71 214 65 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Photobacterium phosphoreum
Q086C4 7e-71 213 63 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella frigidimarina (strain NCIMB 400)
Q494E6 9.51e-71 213 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Blochmanniella pennsylvanica (strain BPEN)
A8H1Q5 1.03e-70 213 63 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q0HXJ1 4.66e-70 211 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sp. (strain MR-7)
Q0HL88 4.66e-70 211 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sp. (strain MR-4)
Q8EBP3 4.66e-70 211 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q87RU4 7.88e-70 210 63 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWU0 7.88e-70 210 63 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio campbellii (strain ATCC BAA-1116)
A9KYJ1 1.11e-69 210 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS195)
A6WR47 1.11e-69 210 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS185)
A3D7C5 1.11e-69 210 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6W6 1.11e-69 210 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella baltica (strain OS223)
A8FSR4 1.54e-69 210 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sediminis (strain HAW-EB3)
A1RHD5 1.81e-69 209 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella sp. (strain W3-18-1)
A4Y961 1.81e-69 209 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B0TJZ0 1.85e-69 209 62 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella halifaxensis (strain HAW-EB4)
B1KJK4 3.9e-69 209 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q12Q43 5.01e-69 208 61 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A3QC62 1.39e-68 207 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8CJN2 6.43e-68 206 60 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A1S4C0 2.45e-67 204 61 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q485J2 2.85e-67 204 63 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q7MN53 3.4e-67 204 62 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio vulnificus (strain YJ016)
Q8DF99 3.4e-67 204 62 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio vulnificus (strain CMCP6)
Q15W98 8.07e-67 203 60 0 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9KPU4 1.47e-66 202 61 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5QVF0 4.12e-65 198 59 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3II28 6.81e-65 198 62 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudoalteromonas translucida (strain TAC 125)
B8D7Y8 1.5e-62 192 55 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9N6 1.5e-62 192 55 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q9ZNM0 2.22e-62 192 55 0 155 2 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q7VM44 2.28e-62 191 61 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6F6V3 9.66e-62 190 63 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q88QH6 6e-61 188 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KL70 6e-61 188 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas putida (strain GB-1)
A5VXW0 6e-61 188 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFM0 6e-61 188 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas entomophila (strain L48)
Q01994 9.28e-61 187 60 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase (Fragment) Photobacterium leiognathi
A4VHT4 1.21e-60 187 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Stutzerimonas stutzeri (strain A1501)
A4IQG7 2.17e-60 186 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacillus thermodenitrificans (strain NG80-2)
Q8K9A6 2.36e-60 186 51 0 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9HWX5 3.86e-60 186 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02SM0 3.86e-60 186 56 1 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7Q5 3.86e-60 186 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain LESB58)
A6V049 3.86e-60 186 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas aeruginosa (strain PA7)
Q8RIR4 5.61e-60 185 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B9MPC6 7.53e-60 185 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q7VRI2 1.11e-59 185 54 1 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Blochmanniella floridana
B8F5Z8 1.19e-59 184 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Glaesserella parasuis serovar 5 (strain SH0165)
B0V9X5 1.26e-59 184 61 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain AYE)
A3MA34 1.26e-59 184 61 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VPU0 1.26e-59 184 61 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain SDF)
B2I1Q0 1.26e-59 184 61 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain ACICU)
B7I251 1.26e-59 184 61 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain AB0057)
B7GUW3 1.26e-59 184 61 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acinetobacter baumannii (strain AB307-0294)
Q889Q6 1.31e-59 184 55 1 155 3 ribH1 6,7-dimethyl-8-ribityllumazine synthase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A2RLD8 1.79e-59 184 56 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lactococcus lactis subsp. cremoris (strain MG1363)
B0K0Z0 3.45e-59 183 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermoanaerobacter sp. (strain X514)
Q5KXK7 3.77e-59 183 56 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacillus kaustophilus (strain HTA426)
B2VAC3 3.85e-59 183 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurihydrogenibium sp. (strain YO3AOP1)
A4XZ35 5.39e-59 183 54 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudomonas mendocina (strain ymp)
Q21F19 6.29e-59 183 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B7GKI1 6.44e-59 182 57 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
C1DLH8 9.31e-59 182 54 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B3H0P9 1.31e-58 182 58 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0KAI3 1.56e-58 182 55 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A4XHM5 1.61e-58 182 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q2S9R9 1.85e-58 182 62 1 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Hahella chejuensis (strain KCTC 2396)
A6TM20 2.22e-58 181 56 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Alkaliphilus metalliredigens (strain QYMF)
C5D3M9 2.98e-58 181 57 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacillus sp. (strain WCH70)
Q9CGU6 4.09e-58 181 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lactococcus lactis subsp. lactis (strain IL1403)
C4Z8N0 4.72e-58 181 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B5ELV8 7.63e-58 180 58 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J444 7.63e-58 180 58 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B0BTN9 7.89e-58 180 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A8FER2 8.06e-58 180 56 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus pumilus (strain SAFR-032)
B1IL45 1.07e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Okra / Type B1)
B1KZ46 1.41e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Loch Maree / Type A3)
A7GH84 1.41e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C1FV67 1.41e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Kyoto / Type A2)
A5I5U9 1.41e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXC4 1.41e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain ATCC 19397 / Type A)
C1CP44 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CI69 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain P1031)
C1CBX9 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain JJA)
P66041 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS11 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain CGSP14)
P66040 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKD0 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8F3 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain Hungary19A-6)
C1CAI5 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae (strain 70585)
B5E6C6 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae serotype 19F (strain G54)
Q04MR3 1.54e-57 179 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q897Q7 1.7e-57 179 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium tetani (strain Massachusetts / E88)
P50856 2.63e-57 179 57 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae
Q0ABQ4 3.97e-57 178 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C3L2U0 4.74e-57 178 54 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain 657 / Type Ba4)
Q31FT1 1.2e-56 177 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A8Z4J3 1.84e-56 176 57 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain USA300 / TCH1516)
A6QHU9 1.84e-56 176 57 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain Newman)
Q5HF08 1.84e-56 176 57 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain COL)
Q2YTM0 1.84e-56 176 57 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FXG2 1.84e-56 176 57 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFX3 1.84e-56 176 57 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain USA300)
A0Q3H6 2.17e-56 176 54 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium novyi (strain NT)
P61597 2.58e-56 176 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain MW2)
P0C600 2.58e-56 176 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus
Q6G8G2 2.58e-56 176 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain MSSA476)
P99141 2.58e-56 176 56 2 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain N315)
P61595 2.58e-56 176 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ITT7 2.58e-56 176 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain JH9)
A6U2N1 2.58e-56 176 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain JH1)
A7X3K7 2.58e-56 176 56 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B9M1E6 3.58e-56 176 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B1H0H9 3.79e-56 176 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Endomicrobium trichonymphae
A3MZA3 4.05e-56 176 56 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q6GFT6 5.5e-56 175 60 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus aureus (strain MRSA252)
C5BS85 6.76e-56 175 54 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q0TTN7 1.18e-55 174 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B8FJ77 1.35e-55 174 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfatibacillum aliphaticivorans
Q0SVI9 1.94e-55 174 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium perfringens (strain SM101 / Type A)
Q8XMW9 1.94e-55 174 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium perfringens (strain 13 / Type A)
A5G3J9 2.43e-55 174 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geotalea uraniireducens (strain Rf4)
Q8ELL1 2.69e-55 174 58 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C0QVI8 3.93e-55 173 56 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A6LSS9 4.3e-55 173 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q89AB1 4.66e-55 173 52 0 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B3E758 4.84e-55 173 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B2V4J4 5.07e-55 173 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Alaska E43 / Type E3)
Q24WY8 5.17e-55 173 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfitobacterium hafniense (strain Y51)
B8FXB6 5.17e-55 173 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A9B4R4 5.35e-55 173 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A1WVG1 5.57e-55 173 53 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Halorhodospira halophila (strain DSM 244 / SL1)
Q8D291 6.37e-55 172 48 0 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Wigglesworthia glossinidia brevipalpis
B5E854 7.74e-55 172 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A5MZ82 9.86e-55 172 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E377 9.86e-55 172 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium kluyveri (strain NBRC 12016)
C0QT44 1.17e-54 172 52 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Persephonella marina (strain DSM 14350 / EX-H1)
Q6AP94 1.46e-54 172 55 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B2TJ82 1.48e-54 172 53 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium botulinum (strain Eklund 17B / Type B)
A4J6A4 1.56e-54 172 54 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q4L7B0 1.82e-54 171 57 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus haemolyticus (strain JCSC1435)
B7GN04 2.85e-54 171 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q97LG8 6.46e-54 170 52 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q3B1F0 7.45e-54 170 52 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q39V66 7.95e-54 170 52 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A2SQG5 8.77e-54 170 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
A4SGN3 8.97e-54 170 51 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B9LIH3 1.22e-53 169 51 1 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WFR1 1.22e-53 169 51 1 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A5D1C7 1.57e-53 169 55 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P61723 1.69e-53 169 55 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q3Z799 1.81e-53 169 55 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
C6E3M5 2.15e-53 169 54 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Geobacter sp. (strain M21)
Q8E0I2 2.34e-53 169 50 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E657 2.34e-53 169 50 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1V6 2.34e-53 169 50 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q2LQN1 2.48e-53 169 53 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Syntrophus aciditrophicus (strain SB)
P11998 3.64e-53 168 50 1 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus subtilis (strain 168)
A7Z674 4.19e-53 168 50 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A1ANJ6 4.23e-53 168 52 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A9VG51 5.4e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus mycoides (strain KBAB4)
Q6HE53 5.4e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635G9 5.4e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain ZK / E33L)
C1EQY6 5.4e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain 03BB102)
A0RIB4 5.4e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus thuringiensis (strain Al Hakam)
Q44681 5.45e-53 167 50 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus amyloliquefaciens
B7JLW7 5.77e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain AH820)
Q81MB5 5.77e-53 167 54 1 150 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus anthracis
C3LIX8 5.77e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7P8 5.77e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus anthracis (strain A0248)
Q3AUB5 7.16e-53 167 51 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium chlorochromatii (strain CaD3)
B9IWX5 7.5e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain Q1)
B7HNM9 7.5e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain AH187)
B4SGD1 7.56e-53 167 52 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
P61719 7.66e-53 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8CNU3 9.03e-53 167 54 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNE4 9.03e-53 167 54 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B3EHV0 9.51e-53 167 53 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q3AC30 1.01e-52 167 53 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B7HAY5 1.02e-52 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain B4264)
A0LI20 1.04e-52 167 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q3A4L3 1.06e-52 167 52 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q818X5 1.12e-52 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7IWM6 1.12e-52 167 54 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus cereus (strain G9842)
Q3ZY85 1.16e-52 167 53 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Dehalococcoides mccartyi (strain CBDB1)
A5FQE3 1.16e-52 167 53 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A3DBL9 2.16e-52 166 52 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A7H4Z4 2.41e-52 166 51 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
O24854 2.93e-52 166 50 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q01T71 3.59e-52 166 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Solibacter usitatus (strain Ellin6076)
A1BJF9 3.61e-52 166 53 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q49YJ6 3.91e-52 166 53 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5HW84 9.88e-52 164 51 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni (strain RM1221)
A1VYA3 9.88e-52 164 51 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PIB9 9.88e-52 164 51 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FKH0 9.88e-52 164 51 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B1I2D4 1.1e-51 164 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulforudis audaxviator (strain MP104C)
A1VEL0 1.16e-51 164 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratidesulfovibrio vulgaris (strain DP4)
P61940 1.16e-51 164 51 1 154 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B8I3K7 1.23e-51 164 53 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B3QWR1 1.54e-51 164 50 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q17Z25 2.24e-51 164 49 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter acinonychis (strain Sheeba)
B8DJF2 2.63e-51 163 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B3QL67 2.91e-51 163 50 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B5Z6D8 3.69e-51 163 50 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain G27)
B8J193 4.55e-51 163 51 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B5YHQ1 4.98e-51 162 48 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q5WH07 5.98e-51 162 54 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Shouchella clausii (strain KSM-K16)
B4S3W8 6.18e-51 162 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B9L729 6.47e-51 162 53 1 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q1MS15 8.28e-51 162 50 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lawsonia intracellularis (strain PHE/MN1-00)
Q1CVF3 9.35e-51 162 50 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain HPAG1)
Q6MCT6 1.02e-50 162 49 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Protochlamydia amoebophila (strain UWE25)
Q30YL2 1.22e-50 162 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B3EL33 1.27e-50 162 49 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobium phaeobacteroides (strain BS1)
Q5SLF7 2.14e-50 161 54 1 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P61728 2.14e-50 161 54 1 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q2RK04 2.92e-50 161 50 2 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C4XHY9 3.15e-50 160 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q8KAW4 4.1e-50 160 50 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q054N5 6.16e-50 160 56 2 136 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04Q79 6.16e-50 160 56 2 136 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B6JPA1 7.14e-50 160 49 2 157 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain P12)
Q9KCL4 7.37e-50 160 53 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B1YEJ3 8.1e-50 159 51 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B9KFN9 9.59e-50 159 48 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q9ZN56 1.97e-49 159 49 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain J99 / ATCC 700824)
B2UW06 2.74e-49 158 48 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter pylori (strain Shi470)
Q8F8T9 2.91e-49 158 57 2 136 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q88X16 3e-49 158 47 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B9E7J1 4.34e-49 158 56 2 139 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Macrococcus caseolyticus (strain JCSC5402)
P61724 5.49e-49 157 57 2 136 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
C6BYC7 5.5e-49 157 46 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
O68250 7.98e-49 157 51 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurospirillum multivorans
C5CJ15 8.52e-49 157 47 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A7HZG0 2.16e-48 156 48 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A8ZTU7 2.32e-48 156 50 1 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B9DN29 2.34e-48 156 56 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Staphylococcus carnosus (strain TM300)
A0L3Z9 2.65e-48 156 47 1 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C0QKW7 4.88e-48 155 50 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B4UIM2 5.76e-48 155 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter sp. (strain K)
B8JEW4 5.76e-48 155 51 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A7ZBS6 8.26e-48 154 50 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter concisus (strain 13826)
A5ILQ1 3.46e-47 153 49 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
O66529 8.49e-47 152 46 1 155 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Aquifex aeolicus (strain VF5)
A0RQJ7 9.85e-47 152 49 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter fetus subsp. fetus (strain 82-40)
Q8GLK5 1.71e-46 151 47 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aquifex pyrophilus
Q30TJ8 2.42e-46 151 49 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B1LAJ8 2.75e-46 151 48 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga sp. (strain RQ2)
Q9X2E5 2.75e-46 151 48 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B9K7K0 3.06e-46 151 47 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A6QBK7 3.46e-46 150 49 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Sulfurovum sp. (strain NBC37-1)
Q1J1M8 3.66e-46 150 49 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q65HW7 5.37e-46 150 53 1 132 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q7VK54 7.02e-46 150 47 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A7HDY3 1.15e-45 149 51 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter sp. (strain Fw109-5)
Q1D349 1.17e-45 149 53 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Myxococcus xanthus (strain DK1622)
A6Q4R0 1.75e-45 149 47 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitratiruptor sp. (strain SB155-2)
Q7MAF0 6.37e-45 147 48 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A8EVW3 1.1e-44 147 47 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aliarcobacter butzleri (strain RM4018)
B0ST02 1.13e-44 147 51 4 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SB77 1.13e-44 147 51 4 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q03XY9 5.01e-44 145 40 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A7GWZ6 6.58e-44 145 47 2 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Campylobacter curvus (strain 525.92)
A9BD87 1.42e-43 144 46 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9211)
P73527 2.69e-43 143 44 3 159 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9XH32 3.53e-43 145 47 1 146 1 None 6,7-dimethyl-8-ribityllumazine synthase, chloroplastic Spinacia oleracea
Q5JD31 6.09e-43 142 46 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
C1CYL1 3.52e-42 140 45 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A3PFD1 1.04e-41 139 45 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9301)
Q7UZL7 1.14e-41 139 43 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q317Z9 1.27e-41 139 44 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9312)
Q03D86 1.45e-41 139 43 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A2BZ29 1.82e-41 139 43 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9515)
A2BTM4 1.94e-41 139 45 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain AS9601)
Q46IE7 3.2e-41 138 45 3 159 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain NATL2A)
A8G7E8 5.29e-41 137 44 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9215)
Q3MCG0 5.6e-41 138 44 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8DMP4 7.43e-41 137 44 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8YQ43 9.54e-41 138 43 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9RXZ8 1.16e-40 136 43 1 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A2C5A7 1.98e-40 136 44 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain NATL1A)
B6YUQ8 3.91e-40 135 44 2 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermococcus onnurineus (strain NA1)
B1XLJ1 4.15e-40 135 47 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A5GQ24 4.41e-40 135 43 3 158 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain RCC307)
Q3B0Q0 5.04e-40 135 42 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain CC9902)
Q5N0X6 9.47e-40 135 42 3 159 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31KZ5 9.47e-40 135 42 3 159 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
C5A697 1.23e-39 134 43 2 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q2ILH7 1.63e-39 134 48 1 132 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q7V9M7 2.1e-39 133 43 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q7UA19 2.68e-39 133 44 2 146 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Parasynechococcus marenigrum (strain WH8102)
Q83DP8 6.31e-39 132 45 1 142 1 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NCD4 6.31e-39 132 45 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J134 6.31e-39 132 45 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain CbuG_Q212)
Q7V977 9.03e-39 132 44 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9313)
Q0IE03 9.28e-39 132 45 2 146 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain CC9311)
A2C5T7 1.72e-38 131 44 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Prochlorococcus marinus (strain MIT 9303)
Q2S3N1 2.37e-38 130 43 1 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Salinibacter ruber (strain DSM 13855 / M31)
B1MYJ5 3.46e-38 130 43 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leuconostoc citreum (strain KM20)
A1AWF3 4.59e-38 130 44 3 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ruthia magnifica subsp. Calyptogena magnifica
O80575 7.29e-38 132 45 1 139 1 At2g44050 6,7-dimethyl-8-ribityllumazine synthase, chloroplastic Arabidopsis thaliana
B6J943 8.08e-38 129 44 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain CbuK_Q154)
Q7NLS9 8.75e-38 130 42 2 147 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A9KC67 1.17e-37 129 44 1 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Coxiella burnetii (strain Dugway 5J108-111)
A5GHU9 1.25e-37 129 42 2 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain WH7803)
Q3ANH6 1.83e-37 129 42 2 148 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Synechococcus sp. (strain CC9605)
B1WW99 2.18e-37 129 45 2 146 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A6L8H3 3.19e-37 128 44 1 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B2G7B1 5.07e-37 127 39 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJX0 5.07e-37 127 39 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Limosilactobacillus reuteri (strain DSM 20016)
B0JLM0 2.17e-36 126 42 2 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q7MUR5 2.18e-36 125 46 1 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RJ75 2.43e-36 125 46 1 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A6L3K7 3.66e-35 123 40 1 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q03PZ7 4.36e-35 122 43 1 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8U4L8 5.48e-35 122 41 3 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B2SNW4 6.96e-35 122 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZ91 6.96e-35 122 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q87AS7 1.31e-34 121 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U4K3 1.31e-34 121 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain M12)
B2I8Q5 1.31e-34 121 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain M23)
Q9PES4 2.16e-34 120 42 1 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xylella fastidiosa (strain 9a5c)
B2FNL3 2.88e-34 120 43 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Stenotrophomonas maltophilia (strain K279a)
A5CWS3 3.16e-34 120 40 2 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q821P5 5.49e-34 119 40 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9A9S4 9.39e-34 119 44 2 143 3 ribH1 6,7-dimethyl-8-ribityllumazine synthase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B4SJC0 1.2e-33 119 43 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Stenotrophomonas maltophilia (strain R551-3)
C1A8F6 1.36e-33 119 47 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q3BXI0 1.49e-33 118 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PPD6 1.49e-33 118 42 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas axonopodis pv. citri (strain 306)
B2JED1 1.81e-33 119 45 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1H425 4.98e-33 117 43 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8PCM7 9.07e-33 116 41 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVD2 9.07e-33 116 41 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UQU3 9.07e-33 116 41 1 152 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Xanthomonas campestris pv. campestris (strain 8004)
A1K280 1.43e-32 116 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Azoarcus sp. (strain BH72)
Q63RP5 2.18e-32 116 45 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia pseudomallei (strain K96243)
A3NCF9 2.18e-32 116 45 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia pseudomallei (strain 668)
A3NY88 2.18e-32 116 45 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia pseudomallei (strain 1106a)
A1V1K5 2.18e-32 116 45 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain SAVP1)
Q62HV4 2.18e-32 116 45 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain ATCC 23344)
A2S9D4 2.18e-32 116 45 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain NCTC 10229)
A3MMR3 2.18e-32 116 45 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia mallei (strain NCTC 10247)
Q89ZW8 3.77e-32 114 40 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B4RJT4 4.8e-32 114 43 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria gonorrhoeae (strain NCCP11945)
Q5F9X9 4.8e-32 114 43 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9AF24 8.05e-32 114 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia multivorans (strain ATCC 17616 / 249)
A4JC82 1.05e-31 114 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BHJ7 1.11e-31 114 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A1KSU7 1.32e-31 114 43 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A1TPC1 1.66e-31 113 43 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paracidovorax citrulli (strain AAC00-1)
Q13V36 2.07e-31 113 43 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paraburkholderia xenovorans (strain LB400)
B2T6D0 2.07e-31 113 43 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q64XS0 2.72e-31 112 39 1 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bacteroides fragilis (strain YCH46)
Q5L4Z3 3.16e-31 112 35 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia abortus (strain DSM 27085 / S26/3)
Q1BYB6 3.28e-31 113 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia orbicola (strain AU 1054)
B1JX76 3.28e-31 113 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia orbicola (strain MC0-3)
B4EBT8 3.28e-31 113 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K5D2 3.28e-31 113 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia cenocepacia (strain HI2424)
B1YUJ2 4.63e-31 112 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Burkholderia ambifaria (strain MC40-6)
P66037 5.33e-31 112 42 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66036 5.33e-31 112 42 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2W8 5.33e-31 112 42 2 151 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Neisseria meningitidis serogroup C (strain 053442)
Q5P3H3 7.38e-31 111 42 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A6WCA2 1.32e-30 111 44 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q11NR0 1.54e-30 111 46 3 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
O84737 1.59e-30 110 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BAI7 1.59e-30 110 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KKW2 1.59e-30 110 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B8V8 1.59e-30 110 39 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q9PLJ4 2.06e-30 110 37 2 156 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia muridarum (strain MoPn / Nigg)
P61720 2.06e-30 111 43 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q255Z6 3.26e-30 110 37 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia felis (strain Fe/C-56)
A1W9I3 3.79e-30 110 41 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidovorax sp. (strain JS42)
B9MBL6 5.3e-30 109 41 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidovorax ebreus (strain TPSY)
Q7NVF3 5.88e-30 109 40 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q129J1 9.95e-30 108 42 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q8Y1H8 1.64e-29 108 42 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q21V18 2.49e-29 107 43 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q3SGU9 2.51e-29 107 39 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thiobacillus denitrificans (strain ATCC 25259)
Q0K7T9 2.98e-29 108 41 3 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A0LZH6 6.63e-29 107 40 3 149 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q474N4 8.2e-29 107 42 3 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B2U7F0 1.05e-28 106 41 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Ralstonia pickettii (strain 12J)
C1DB32 1.21e-28 106 42 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Laribacter hongkongensis (strain HLHK9)
Q8FT58 1.5e-28 105 43 4 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
C4LIS3 2.32e-28 105 41 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B1W4A5 2.47e-28 105 41 3 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q8NQ53 2.79e-28 105 42 4 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEG8 2.79e-28 105 42 4 150 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium glutamicum (strain R)
Q2YD51 2.89e-28 105 40 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q82S08 2.99e-28 105 42 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1WS77 3.67e-28 104 41 2 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Verminephrobacter eiseniae (strain EF01-2)
A1VRD9 4.42e-28 104 42 2 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Polaromonas naphthalenivorans (strain CJ2)
A0LUD3 6.83e-28 104 42 3 153 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q9EWJ9 8.78e-28 103 39 3 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A6H143 1.4e-27 104 39 1 138 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
C3PG33 1.57e-27 103 41 3 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A2SK12 1.64e-27 103 38 2 143 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q827L9 1.95e-27 103 39 3 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7VTN4 4.45e-27 102 41 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W143 4.69e-27 102 41 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WNT3 4.69e-27 102 41 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q0AD61 6.27e-27 102 42 2 136 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9UUB1 1.15e-26 101 39 1 141 1 rib4 6,7-dimethyl-8-ribityllumazine synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1LJV9 1.37e-26 101 38 3 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A5FNH3 1.46e-26 101 38 2 140 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B1XYF6 3.54e-26 99 40 3 154 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B8H6T9 6.99e-26 99 43 3 128 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A5V939 7.08e-26 98 42 3 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q6A6Y6 9.57e-26 99 36 3 141 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A9WR65 1.04e-25 98 40 3 144 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A9I6G5 1.48e-25 99 40 2 142 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q47QZ8 2.51e-25 98 42 3 137 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Thermobifida fusca (strain YX)
Q9Z733 2.58e-25 97 31 2 155 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Chlamydia pneumoniae
Q7UGV1 3.19e-25 97 37 1 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1SJG9 3.31e-25 97 41 4 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A4FBK5 3.75e-25 97 44 3 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A5CPK0 1.19e-24 95 40 3 145 3 ribH 6,7-dimethyl-8-ribityllumazine synthase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00395
Feature type CDS
Gene ribE
Product 6,7-dimethyl-8-ribityllumazine synthase
Location 110783 - 111253 (strand: 1)
Length 471 (nucleotides) / 156 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2291
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00885 6,7-dimethyl-8-ribityllumazine synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0054 Coenzyme transport and metabolism (H) H 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)

Kegg Ortholog Annotation(s)

Protein Sequence

MNVIKGVVAAPNARVAIAIARFNNFINDSLLEGAVDALERIGQVSSENITVVWVPGAYELPLTVKALVESDKYDAVIALGTVIRGGTAHFEYVAGECSSGLSHVAMQSEIPVTFGVLTTESIEQAIERAGTKAGNKGAEAAMTALEMINVLKAIKG

Flanking regions ( +/- flanking 50bp)

AAAGAATGTGATAAAATCCGCGCCCCGCGGATAGGAGAAAAAGGTAACCTATGAACGTAATCAAAGGTGTTGTCGCGGCGCCAAACGCACGTGTAGCGATTGCAATTGCCCGTTTTAATAATTTTATTAATGATAGCTTGTTAGAAGGTGCCGTTGATGCACTTGAGCGTATCGGACAAGTTTCCTCAGAAAATATTACCGTCGTTTGGGTTCCTGGTGCTTATGAGTTGCCATTAACTGTAAAAGCATTAGTAGAAAGCGACAAATATGATGCCGTTATCGCGTTAGGCACTGTTATCCGTGGTGGAACCGCACATTTTGAATACGTTGCTGGCGAATGCAGCTCTGGCCTTTCTCATGTTGCAATGCAAAGTGAGATCCCTGTGACTTTTGGTGTATTAACCACTGAAAGCATTGAGCAGGCAATTGAACGAGCTGGTACTAAAGCGGGCAATAAAGGTGCTGAAGCTGCAATGACAGCACTTGAAATGATCAATGTACTTAAAGCCATTAAAGGCTAATCATCTGTTTTAACTAAAGGGGAATTTTGTGAAACCTGCTGCTCGTCGTC