Homologs in group_3474

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_10790 EHELCC_10790 100.0 Morganella morganii S2 - Tyrosine-type recombinase/integrase
NLDBIP_11135 NLDBIP_11135 100.0 Morganella morganii S4 - Tyrosine-type recombinase/integrase
LHKJJB_10220 LHKJJB_10220 100.0 Morganella morganii S3 - Tyrosine-type recombinase/integrase
HKOGLL_16385 HKOGLL_16385 100.0 Morganella morganii S5 - Tyrosine-type recombinase/integrase

Distribution of the homologs in the orthogroup group_3474

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3474

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9F771 2.9e-51 177 33 7 317 3 xerC Putative tyrosine recombinase XerC Pseudomonas aeruginosa
Q8KRZ2 3.22e-44 160 28 4 316 3 xerC Putative tyrosine recombinase XerC Pseudomonas syringae
B3E1H7 4.76e-10 63 27 16 322 3 xerC Tyrosine recombinase XerC Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B3DQV1 1.89e-08 58 28 5 165 3 xerC Tyrosine recombinase XerC Bifidobacterium longum (strain DJO10A)
Q9KA25 6.55e-08 56 24 11 293 3 xerC Tyrosine recombinase XerC Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B7GQE1 6.56e-08 57 27 5 165 3 xerC Tyrosine recombinase XerC Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B7GGC7 1.85e-07 55 25 9 262 3 xerC Tyrosine recombinase XerC Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A1AKP9 2.72e-07 54 23 12 307 3 xerC Tyrosine recombinase XerC Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q980D9 3.04e-07 54 28 4 159 1 xerA Tyrosine recombinase XerA Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q7ZAM5 5.79e-07 53 23 8 258 3 xerC Tyrosine recombinase XerC Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8TZV9 7.19e-07 53 26 7 159 3 xerA Tyrosine recombinase XerA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q5JHA3 1.24e-06 52 23 13 317 3 xerA Tyrosine recombinase XerA Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A1SQX0 2.88e-06 51 28 4 145 3 xerC Tyrosine recombinase XerC Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7ZAJ4 3.38e-06 51 29 6 162 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPU0 3.38e-06 51 29 6 162 3 xerC Tyrosine recombinase XerC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A0P1 1.15e-05 49 20 13 320 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MW2)
P0A0P2 1.15e-05 49 20 13 320 3 xerD Tyrosine recombinase XerD Staphylococcus aureus
Q6G967 1.15e-05 49 20 13 320 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MSSA476)
Q6GGK1 1.15e-05 49 20 13 320 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain MRSA252)
P0A0P0 1.15e-05 49 20 13 320 1 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain N315)
P0A0N9 1.15e-05 49 20 13 320 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFS5 1.15e-05 49 20 13 320 3 xerD Tyrosine recombinase XerD Staphylococcus aureus (strain COL)
O59490 1.24e-05 49 22 5 158 3 xerA Tyrosine recombinase XerA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q253S9 1.38e-05 49 26 4 150 3 xerC Tyrosine recombinase XerC Chlamydia felis (strain Fe/C-56)
P67631 1.45e-05 49 29 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain N315)
P67630 1.45e-05 49 29 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X1M7 1.45e-05 49 29 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain Mu3 / ATCC 700698)
A5ISD6 1.49e-05 49 29 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain JH9)
A6U170 1.49e-05 49 29 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain JH1)
B9DPG4 1.6e-05 49 28 6 163 3 xerC Tyrosine recombinase XerC Staphylococcus carnosus (strain TM300)
Q9KJF6 1.8e-05 49 29 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus
Q9PK47 2.1e-05 49 25 4 156 3 xerC Tyrosine recombinase XerC Chlamydia muridarum (strain MoPn / Nigg)
Q49X37 2.12e-05 48 27 6 163 3 xerC Tyrosine recombinase XerC Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7ZAM3 2.13e-05 48 19 11 317 3 xerD Tyrosine recombinase XerD Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B7IFN3 2.26e-05 48 27 6 152 3 THA_404 Tyrosine recombinase THA_404 Thermosipho africanus (strain TCF52B)
A0QVB4 2.94e-05 48 26 5 163 3 xerC Tyrosine recombinase XerC Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q823T9 3.54e-05 48 27 4 150 3 xerC Tyrosine recombinase XerC Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q2YXL6 3.59e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8Z3T2 3.65e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain USA300 / TCH1516)
A6QGF2 3.65e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain Newman)
Q5HGI0 3.65e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain COL)
Q2FZ30 3.65e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHI6 3.65e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain USA300)
Q6GHI3 3.69e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain MRSA252)
Q8NWZ8 3.79e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain MW2)
Q6G9W1 3.79e-05 48 28 5 162 3 xerC Tyrosine recombinase XerC Staphylococcus aureus (strain MSSA476)
Q9V1P5 4.49e-05 48 25 7 158 1 xerA Tyrosine recombinase XerA Pyrococcus abyssi (strain GE5 / Orsay)
Q8NNZ9 6.29e-05 47 25 4 150 3 xerC Tyrosine recombinase XerC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q1D804 7.07e-05 47 26 6 169 3 xerC Tyrosine recombinase XerC Myxococcus xanthus (strain DK1622)
P59818 7.07e-05 47 26 6 169 3 xerC Tyrosine recombinase XerC Myxococcus xanthus
Q5L6G3 7.84e-05 47 22 8 258 3 xerC Tyrosine recombinase XerC Chlamydia abortus (strain DSM 27085 / S26/3)
Q7ZAK0 9.42e-05 47 30 6 150 3 xerC Tyrosine recombinase XerC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A0LEB8 9.94e-05 47 27 5 159 3 xerC Tyrosine recombinase XerC Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q9Z9F7 0.000253 45 26 4 150 3 xerC Tyrosine recombinase XerC Chlamydia pneumoniae
O84351 0.000262 45 25 4 156 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BBY1 0.000262 45 25 4 156 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KM11 0.000262 45 25 4 156 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B7R6 0.000262 45 25 4 156 3 xerC Tyrosine recombinase XerC Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B3QM22 0.000272 45 21 13 325 3 xerC Tyrosine recombinase XerC Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q720E4 0.000334 45 25 11 256 3 xerC Tyrosine recombinase XerC Listeria monocytogenes serotype 4b (strain F2365)
C1L2I5 0.000334 45 25 11 256 3 xerC Tyrosine recombinase XerC Listeria monocytogenes serotype 4b (strain CLIP80459)
B9DUD2 0.000376 45 24 4 163 3 xerS Tyrosine recombinase XerS Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q9HXQ6 0.000498 44 30 7 159 3 xerD Tyrosine recombinase XerD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
C0MFD9 0.000557 45 26 5 163 3 xerS Tyrosine recombinase XerS Streptococcus equi subsp. zooepidemicus (strain H70)
B4U2Z3 0.000599 44 26 5 163 3 xerS Tyrosine recombinase XerS Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q8NQL5 0.000613 44 26 6 164 3 xerD Tyrosine recombinase XerD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q5HP53 0.000733 44 21 14 321 3 xerD Tyrosine recombinase XerD Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7NVH1 0.000835 44 31 9 152 3 xerC Tyrosine recombinase XerC Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P67633 0.000879 44 25 5 162 3 xerS Tyrosine recombinase XerS Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P67632 0.000879 44 25 5 162 3 xerS Tyrosine recombinase XerS Streptococcus agalactiae serotype III (strain NEM316)
Q3K1A9 0.000879 44 25 5 162 3 xerS Tyrosine recombinase XerS Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C0MBC3 0.000887 44 26 5 163 3 xerS Tyrosine recombinase XerS Streptococcus equi subsp. equi (strain 4047)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_16670
Feature type CDS
Gene -
Product Tyrosine-type recombinase/integrase
Location 16781 - 17743 (strand: -1)
Length 963 (nucleotides) / 320 (amino acids)

Contig

Accession contig_25
Length 47933 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3474
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00589 Phage integrase family
PF13102 Phage integrase SAM-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4974 Replication, recombination and repair (L) L Site-specific recombinase XerD

Protein Sequence

MNDITFEYLTEQYFYSKSLRPAAISSYRKVVRTFEAFTAVPPADVDHHIVLRWRNHVLKDEKRAPRTWNNKVTHMRALFNFAIAQGFLPHEQNPFHYAVVRAGKKRKKILTKSQMDALYRRVDFYLNIEKAHGCCVLYNGRVNAMHPAWFWGTAINVLRYTAIRMSQLLHIRLCDVSLEDRWIDLSSGGSKNHDEHRVPVVTALYPSLAYLLERAEEAGMEPEHQLFNVGWFDLRRKYKYPELMDERPLRAFFRRLSRECNFTISPHRFRHTVATHMMKSPERNLYVVKRLLGHVSLVSTLEYIDESVDGLRNILETELM

Flanking regions ( +/- flanking 50bp)

TAACACGCGTCTTTTCCGGTTTTATAGCAGGCTGTAAAAAAGAGTACGTTATGAATGATATTACGTTTGAATACCTGACAGAGCAGTATTTTTACAGTAAATCACTGCGTCCGGCGGCGATAAGCAGTTACCGGAAAGTTGTCCGGACCTTTGAAGCGTTTACGGCGGTTCCGCCTGCGGACGTGGATCATCATATCGTACTGCGCTGGCGTAACCACGTTCTGAAAGACGAAAAACGGGCACCGAGAACCTGGAATAACAAAGTGACCCATATGAGGGCGCTGTTCAACTTTGCGATAGCGCAGGGATTTTTGCCTCATGAGCAAAATCCGTTTCATTACGCGGTGGTCAGAGCAGGTAAAAAGCGGAAAAAAATCCTGACGAAAAGCCAGATGGATGCGCTGTACCGGCGGGTTGATTTTTATCTGAATATCGAAAAAGCTCACGGTTGCTGTGTGCTGTACAACGGACGCGTCAATGCCATGCATCCGGCGTGGTTCTGGGGCACGGCCATTAATGTGCTGCGCTATACTGCTATCCGGATGAGTCAACTGCTTCATATTCGTTTGTGTGATGTCAGCCTGGAAGACCGCTGGATCGATCTGAGTTCGGGTGGGTCTAAAAACCACGATGAACACCGGGTTCCGGTTGTCACGGCGCTGTATCCGTCGCTGGCCTATTTACTGGAGCGGGCTGAAGAAGCAGGGATGGAGCCGGAGCATCAGCTGTTTAATGTGGGCTGGTTTGATCTGCGCCGGAAATACAAATATCCGGAACTGATGGATGAACGGCCGTTACGGGCATTTTTCCGGCGATTATCCAGGGAATGCAATTTTACTATCTCTCCGCACCGGTTCAGACACACTGTCGCCACTCACATGATGAAATCACCGGAGCGCAATCTGTACGTGGTAAAGCGCCTGCTGGGTCATGTCAGTCTGGTATCAACACTGGAATACATTGATGAAAGTGTTGACGGATTACGTAACATACTGGAAACCGAGCTGATGTAGTGCTCAAAGGGGGAATTTACTGACTGAGTTTGACTTTGACGGAGAAGATC