Homologs in group_2081

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15935 EHELCC_15935 100.0 Morganella morganii S2 recF DNA replication/repair protein RecF
NLDBIP_16435 NLDBIP_16435 100.0 Morganella morganii S4 recF DNA replication/repair protein RecF
LHKJJB_16370 LHKJJB_16370 100.0 Morganella morganii S3 recF DNA replication/repair protein RecF
HKOGLL_16140 HKOGLL_16140 100.0 Morganella morganii S5 recF DNA replication/repair protein RecF
F4V73_RS17585 F4V73_RS17585 94.7 Morganella psychrotolerans recF DNA replication/repair protein RecF
PMI_RS15510 PMI_RS15510 77.5 Proteus mirabilis HI4320 recF DNA replication/repair protein RecF

Distribution of the homologs in the orthogroup group_2081

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2081

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7NAD1 0.0 611 79 0 360 3 recF DNA replication and repair protein RecF Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G7Q4 0.0 595 78 1 360 3 recF DNA replication and repair protein RecF Serratia proteamaculans (strain 568)
A7FPB5 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JGD5 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663T4 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R5R3 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9U9 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pestis
A1JT78 0.0 591 77 1 360 3 recF DNA replication and repair protein RecF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VCE1 0.0 590 78 1 360 3 recF DNA replication and repair protein RecF Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B2JYI8 0.0 589 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P22839 0.0 587 77 1 361 3 recF DNA replication and repair protein RecF Proteus mirabilis
B4F0U7 0.0 587 77 1 361 3 recF DNA replication and repair protein RecF Proteus mirabilis (strain HI4320)
C6DGH9 0.0 582 76 1 360 3 recF DNA replication and repair protein RecF Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P24900 0.0 581 76 1 357 3 recF DNA replication and repair protein RecF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z2N4 0.0 581 76 1 357 3 recF DNA replication and repair protein RecF Salmonella typhi
B4SYA6 0.0 581 76 1 357 3 recF DNA replication and repair protein RecF Salmonella newport (strain SL254)
B4TAU7 0.0 581 76 1 357 3 recF DNA replication and repair protein RecF Salmonella heidelberg (strain SL476)
C0Q2K7 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi C (strain RKS4594)
B5RFY9 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUP8 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella enteritidis PT4 (strain P125109)
B5FN08 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella dublin (strain CT_02021853)
Q57I02 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella choleraesuis (strain SC-B67)
B5EYB2 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella agona (strain SL483)
A9MX74 0.0 579 76 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5BIL2 0.0 578 75 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi A (strain AKU_12601)
Q5PKU8 0.0 578 75 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MJU2 0.0 578 75 1 357 3 recF DNA replication and repair protein RecF Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4TN05 0.0 577 75 1 357 3 recF DNA replication and repair protein RecF Salmonella schwarzengrund (strain CVM19633)
Q6CYR6 0.0 577 75 1 360 3 recF DNA replication and repair protein RecF Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4W4R3 0.0 575 74 1 357 3 recF DNA replication and repair protein RecF Enterobacter sp. (strain 638)
Q7BZ80 0.0 574 75 1 357 3 recF DNA replication and repair protein RecF Shigella flexneri
Q3YWB4 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Shigella sonnei (strain Ss046)
Q1R4N7 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain UTI89 / UPEC)
B1LL25 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain SMS-3-5 / SECEC)
B7NF17 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7H0 0.0 573 75 1 357 1 recF DNA replication and repair protein RecF Escherichia coli (strain K12)
B1IYP4 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7H1 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AHN5 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O1:K1 / APEC
A8A6G1 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O9:H4 (strain HS)
B1X9S9 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain K12 / DH10B)
C4ZYX7 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4I9 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O8 (strain IAI1)
B7N204 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O81 (strain ED1a)
B5YXA2 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7H2 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O157:H7
B7L842 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain 55989 / EAEC)
B7MGC1 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMG7 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTQ6 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ACL2 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B6I3T3 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain SE11)
B7LK42 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q0TB07 0.0 572 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NR02 0.0 572 74 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B2TUS8 0.0 571 74 1 357 3 recF DNA replication and repair protein RecF Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TG02 0.0 571 74 1 357 3 recF DNA replication and repair protein RecF Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q0SYP0 0.0 570 74 1 357 3 recF DNA replication and repair protein RecF Shigella flexneri serotype 5b (strain 8401)
Q31UV3 0.0 570 74 1 357 3 recF DNA replication and repair protein RecF Shigella boydii serotype 4 (strain Sb227)
B5XT53 0.0 569 74 1 357 3 recF DNA replication and repair protein RecF Klebsiella pneumoniae (strain 342)
Q329B8 0.0 566 74 1 357 3 recF DNA replication and repair protein RecF Shigella dysenteriae serotype 1 (strain Sd197)
C5BHC7 0.0 564 74 1 359 3 recF DNA replication and repair protein RecF Edwardsiella ictaluri (strain 93-146)
A7MMZ8 0.0 562 73 1 357 3 recF DNA replication and repair protein RecF Cronobacter sakazakii (strain ATCC BAA-894)
Q2NX47 0.0 555 73 1 361 3 recF DNA replication and repair protein RecF Sodalis glossinidius (strain morsitans)
Q6YI30 0.0 554 73 1 361 3 recF DNA replication and repair protein RecF Sodalis glossinidius
B6EP48 5.13e-158 450 57 2 358 3 recF DNA replication and repair protein RecF Aliivibrio salmonicida (strain LFI1238)
Q5E8Z0 7.48e-157 447 56 2 358 3 recF DNA replication and repair protein RecF Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FEV5 3.53e-156 445 56 1 357 3 recF DNA replication and repair protein RecF Aliivibrio fischeri (strain MJ11)
Q0I0Y5 2.08e-154 441 57 1 358 3 recF DNA replication and repair protein RecF Histophilus somni (strain 129Pt)
B0UUM0 2.92e-154 441 57 1 358 3 recF DNA replication and repair protein RecF Histophilus somni (strain 2336)
Q65VB6 7.98e-152 434 56 2 359 3 recF DNA replication and repair protein RecF Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B7VGI6 3.84e-151 432 55 2 359 3 recF DNA replication and repair protein RecF Vibrio atlanticus (strain LGP32)
Q87TQ5 3.98e-150 430 55 2 359 3 recF DNA replication and repair protein RecF Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MQJ5 2.44e-149 428 55 2 359 3 recF DNA replication and repair protein RecF Vibrio vulnificus (strain YJ016)
P43767 2.61e-149 428 56 1 357 3 recF DNA replication and repair protein RecF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLR9 6.75e-149 427 56 1 357 3 recF DNA replication and repair protein RecF Haemophilus influenzae (strain 86-028NP)
A3MY75 1.11e-148 426 56 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7N1F1 2.36e-148 426 55 2 359 3 recF DNA replication and repair protein RecF Vibrio campbellii (strain ATCC BAA-1116)
Q8DDJ1 2.86e-148 425 55 2 359 3 recF DNA replication and repair protein RecF Vibrio vulnificus (strain CMCP6)
B0BRG1 3.56e-148 425 56 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q9CLQ6 6.06e-148 424 58 2 357 3 recF DNA replication and repair protein RecF Pasteurella multocida (strain Pm70)
B3GZJ3 1.27e-147 424 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
P24718 1.35e-147 424 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae
A6VK88 1.61e-146 421 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VMW3 1.7e-146 421 54 2 362 3 recF DNA replication and repair protein RecF Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C3LP87 7.83e-146 419 54 1 361 3 recF DNA replication and repair protein RecF Vibrio cholerae serotype O1 (strain M66-2)
Q9KVX4 7.83e-146 419 54 1 361 3 recF DNA replication and repair protein RecF Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F493 7.83e-146 419 54 1 361 3 recF DNA replication and repair protein RecF Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B8F744 3.21e-142 410 54 2 361 3 recF DNA replication and repair protein RecF Glaesserella parasuis serovar 5 (strain SH0165)
Q12TC6 4.2e-123 362 49 2 360 3 recF DNA replication and repair protein RecF Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8E3P6 2.03e-120 355 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS223)
A9KU74 6.22e-120 353 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS195)
A3CYH7 6.22e-120 353 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS155 / ATCC BAA-1091)
A6WH87 2.18e-119 352 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS185)
A4Y1A6 3.43e-118 349 48 2 360 3 recF DNA replication and repair protein RecF Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8GYE5 5.54e-118 348 48 2 360 3 recF DNA replication and repair protein RecF Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1RDX9 6.32e-118 348 48 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain W3-18-1)
Q0I0U6 1.46e-117 347 47 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain MR-7)
Q0HPD2 1.59e-117 347 47 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain MR-4)
A3Q8S8 3.17e-117 347 47 2 360 3 recF DNA replication and repair protein RecF Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EKT0 3.42e-117 347 48 2 360 3 recF DNA replication and repair protein RecF Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KR37 6.15e-117 346 47 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain ANA-3)
A1T0X6 5.12e-115 341 44 2 361 3 recF DNA replication and repair protein RecF Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B8CH73 1.02e-114 340 46 2 360 3 recF DNA replication and repair protein RecF Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TLA6 2.77e-114 339 46 2 360 3 recF DNA replication and repair protein RecF Shewanella halifaxensis (strain HAW-EB4)
B1KCX5 2.82e-113 337 46 2 360 3 recF DNA replication and repair protein RecF Shewanella woodyi (strain ATCC 51908 / MS32)
Q08A49 3.86e-113 336 47 2 360 3 recF DNA replication and repair protein RecF Shewanella frigidimarina (strain NCIMB 400)
A8FP48 9.74e-113 335 46 2 360 3 recF DNA replication and repair protein RecF Shewanella sediminis (strain HAW-EB3)
A1S1H1 1.18e-110 330 47 2 358 3 recF DNA replication and repair protein RecF Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0BL82 6.61e-88 271 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. holarctica (strain OSU18)
Q2A2N7 6.61e-88 271 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. holarctica (strain LVS)
A7ND52 6.61e-88 271 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B7V0N8 9.86e-88 271 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain LESB58)
B2SG84 1.11e-87 271 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. mediasiatica (strain FSC147)
Q9I7C3 1.75e-87 271 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02V78 1.75e-87 271 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain UCBPP-PA14)
A4IXB4 1.91e-87 270 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGS0 1.91e-87 270 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14I72 1.91e-87 270 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. tularensis (strain FSC 198)
A0Q5W0 3.11e-87 270 37 2 352 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. novicida (strain U112)
A6UX64 3.57e-87 270 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain PA7)
Q500U5 7.66e-87 269 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas syringae pv. syringae (strain B728a)
A4XN62 4.52e-86 267 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas mendocina (strain ymp)
Q88BK1 4.61e-86 267 38 3 360 3 recF DNA replication and repair protein RecF Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88RW7 9.63e-86 266 39 4 361 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B1J3Y4 1.05e-85 266 38 3 360 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain W619)
A5VWC0 1.05e-85 266 39 4 361 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C3KDU4 1.06e-85 266 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas fluorescens (strain SBW25)
B0KEV1 1.69e-85 266 39 4 361 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain GB-1)
Q1IH46 1.73e-85 266 39 5 365 3 recF DNA replication and repair protein RecF Pseudomonas entomophila (strain L48)
Q4KKS8 2.22e-85 265 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48QJ8 2.84e-85 265 38 3 360 3 recF DNA replication and repair protein RecF Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3KKF9 1.13e-84 264 38 3 360 3 recF DNA replication and repair protein RecF Pseudomonas fluorescens (strain Pf0-1)
B3PEM4 5.96e-84 262 37 4 363 3 recF DNA replication and repair protein RecF Cellvibrio japonicus (strain Ueda107)
Q5QY37 1.11e-83 261 37 2 358 3 recF DNA replication and repair protein RecF Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3IDE8 1.86e-83 260 40 6 327 3 recF DNA replication and repair protein RecF Pseudoalteromonas translucida (strain TAC 125)
A4VFG0 5.4e-83 259 39 4 361 3 recF DNA replication and repair protein RecF Stutzerimonas stutzeri (strain A1501)
B0U178 6.95e-83 258 35 2 352 3 recF DNA replication and repair protein RecF Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
C1DFU4 9.48e-81 253 38 5 364 3 recF DNA replication and repair protein RecF Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q15ZZ5 6.24e-80 251 36 4 362 3 recF DNA replication and repair protein RecF Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1R1P0 3.27e-79 249 36 4 361 3 recF DNA replication and repair protein RecF Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
P13456 1.06e-77 246 37 6 361 3 recF DNA replication and repair protein RecF Pseudomonas putida
B6J8S5 2.45e-76 242 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain CbuK_Q154)
Q83FD6 2.94e-76 242 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N902 2.94e-76 242 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J289 3.69e-76 241 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain CbuG_Q212)
A9KEV0 1.04e-75 240 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain Dugway 5J108-111)
A6VR67 2.54e-74 237 38 3 338 3 recF DNA replication and repair protein RecF Marinomonas sp. (strain MWYL1)
Q31JS3 4.74e-74 236 34 5 361 3 recF DNA replication and repair protein RecF Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B8GSS3 5.23e-71 228 36 3 360 3 recF DNA replication and repair protein RecF Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C5BKM1 2.81e-70 227 35 5 369 3 recF DNA replication and repair protein RecF Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q21PV3 4.04e-68 221 34 6 366 3 recF DNA replication and repair protein RecF Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2SQZ4 2.39e-67 219 31 5 370 3 recF DNA replication and repair protein RecF Hahella chejuensis (strain KCTC 2396)
A1TWJ3 8.7e-65 213 35 8 371 3 recF DNA replication and repair protein RecF Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3JF36 5.77e-63 207 34 4 362 3 recF DNA replication and repair protein RecF Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q48AS5 6.46e-61 203 33 4 337 3 recF DNA replication and repair protein RecF Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q602N2 1.15e-59 199 37 4 361 3 recF DNA replication and repair protein RecF Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8PEH3 2.74e-58 196 34 6 363 3 recF DNA replication and repair protein RecF Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4V0S6 2.74e-58 196 34 6 363 3 recF DNA replication and repair protein RecF Xanthomonas campestris pv. campestris (strain 8004)
Q5H713 7.38e-56 189 34 7 367 3 recF DNA replication and repair protein RecF Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2FT82 2.08e-55 188 33 6 363 3 recF DNA replication and repair protein RecF Stenotrophomonas maltophilia (strain K279a)
Q8PRG0 4.01e-55 187 34 7 366 3 recF DNA replication and repair protein RecF Xanthomonas axonopodis pv. citri (strain 306)
B0VAF5 9.89e-55 186 32 4 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain AYE)
B2HZA5 9.89e-55 186 32 4 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain ACICU)
B7IBH5 9.89e-55 186 32 4 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain AB0057)
B7GUX7 9.89e-55 186 32 4 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain AB307-0294)
A3M0Q6 1.01e-54 186 32 4 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q2P9L9 1.49e-54 186 34 7 364 3 recF DNA replication and repair protein RecF Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B0VMK2 1.56e-54 186 32 6 377 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain SDF)
Q3BZS9 1.76e-54 186 33 6 366 3 recF DNA replication and repair protein RecF Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B4SR07 1.32e-53 183 32 6 363 3 recF DNA replication and repair protein RecF Stenotrophomonas maltophilia (strain R551-3)
Q6FG19 3.04e-53 182 31 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9PHE1 8.93e-52 179 32 5 363 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain 9a5c)
Q87FC4 1.18e-51 178 32 4 361 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5U9 1.18e-51 178 32 4 361 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain M23)
B0U1G7 2.11e-51 177 33 6 364 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain M12)
A8MEA3 2.08e-41 151 27 6 370 3 recF DNA replication and repair protein RecF Alkaliphilus oremlandii (strain OhILAs)
B9M7S3 2.66e-39 146 25 6 367 3 recF DNA replication and repair protein RecF Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B3E8N9 3.01e-39 145 28 5 364 3 recF DNA replication and repair protein RecF Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B5E7P8 3.34e-39 145 28 5 366 3 recF DNA replication and repair protein RecF Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6E7Q7 7.08e-39 145 29 8 370 3 recF DNA replication and repair protein RecF Geobacter sp. (strain M21)
A5FNH5 5.11e-38 142 27 7 352 3 recF DNA replication and repair protein RecF Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B8I3R5 2.96e-37 140 25 7 374 3 recF DNA replication and repair protein RecF Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A5GDX3 1.77e-36 138 25 5 366 3 recF DNA replication and repair protein RecF Geotalea uraniireducens (strain Rf4)
A6H141 1.91e-36 138 25 8 367 3 recF DNA replication and repair protein RecF Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
B0K0X1 1.51e-35 135 25 6 351 3 recF DNA replication and repair protein RecF Thermoanaerobacter sp. (strain X514)
B0KAG3 1.75e-35 135 25 6 351 3 recF DNA replication and repair protein RecF Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6MAG9 4.67e-35 134 27 10 365 3 recF DNA replication and repair protein RecF Protochlamydia amoebophila (strain UWE25)
B8CZN7 6.4e-35 134 26 8 376 3 recF DNA replication and repair protein RecF Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q74H90 1.29e-34 133 28 5 366 3 recF DNA replication and repair protein RecF Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q4A177 1.34e-34 133 25 6 376 3 recF DNA replication and repair protein RecF Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B5XJC1 2.77e-34 132 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M49 (strain NZ131)
Q1JEB8 3.89e-34 132 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8NYZ4 3.89e-34 132 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q056V0 5.17e-34 132 25 4 363 3 recF DNA replication and repair protein RecF Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04WF5 5.17e-34 132 25 4 363 3 recF DNA replication and repair protein RecF Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q9PKW5 5.33e-34 132 26 5 368 3 recF DNA replication and repair protein RecF Chlamydia muridarum (strain MoPn / Nigg)
Q5X9A5 6.64e-34 131 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A6TJ79 8.67e-34 131 27 7 374 3 recF DNA replication and repair protein RecF Alkaliphilus metalliredigens (strain QYMF)
P0DD85 1.28e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD84 1.28e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1J443 1.32e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M4 (strain MGAS10750)
P0C0D1 1.44e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M1
Q48QL2 1.67e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J973 1.67e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8EU85 2.14e-33 130 25 9 380 3 recF DNA replication and repair protein RecF Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q1JJC0 2.37e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M12 (strain MGAS9429)
A9KPP4 2.41e-33 130 25 5 363 3 recF DNA replication and repair protein RecF Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A5N460 2.42e-33 130 23 6 367 3 recF DNA replication and repair protein RecF Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B1MW32 2.99e-33 130 27 7 377 3 recF DNA replication and repair protein RecF Leuconostoc citreum (strain KM20)
Q3A8M6 3.1e-33 129 28 5 363 3 recF DNA replication and repair protein RecF Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A2RH21 3.33e-33 129 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M5 (strain Manfredo)
A0Q3U3 8.26e-33 128 23 5 366 3 recF DNA replication and repair protein RecF Clostridium novyi (strain NT)
C5D330 9.32e-33 129 25 6 373 3 recF DNA replication and repair protein RecF Geobacillus sp. (strain WCH70)
Q8CQK5 1.05e-32 128 24 7 382 3 recF DNA replication and repair protein RecF Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q72WD4 2e-32 127 25 4 363 3 recF DNA replication and repair protein RecF Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q254F3 3.45e-32 127 27 7 369 3 recF DNA replication and repair protein RecF Chlamydia felis (strain Fe/C-56)
B2UX46 3.61e-32 127 22 5 365 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Alaska E43 / Type E3)
B2THB7 3.73e-32 127 22 5 365 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Eklund 17B / Type B)
Q5HK02 4.41e-32 127 24 7 382 3 recF DNA replication and repair protein RecF Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A0LZH4 4.79e-32 126 26 12 374 3 recF DNA replication and repair protein RecF Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q040E6 8.31e-32 126 25 7 381 3 recF DNA replication and repair protein RecF Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B8DAQ5 1.32e-31 125 25 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serotype 4a (strain HCC23)
C4Z940 1.45e-31 125 26 6 366 3 recF DNA replication and repair protein RecF Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q8YAV8 1.55e-31 125 24 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q725G6 1.55e-31 125 24 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serotype 4b (strain F2365)
C1L302 1.55e-31 125 24 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8FA32 1.91e-31 125 25 5 365 3 recF DNA replication and repair protein RecF Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q0SWY1 1.97e-31 125 24 6 364 3 recF DNA replication and repair protein RecF Clostridium perfringens (strain SM101 / Type A)
Q8XPF9 1.97e-31 125 24 6 364 3 recF DNA replication and repair protein RecF Clostridium perfringens (strain 13 / Type A)
Q0TV61 1.97e-31 125 24 6 364 3 recF DNA replication and repair protein RecF Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B0SK33 2.48e-31 124 22 5 367 3 recF DNA replication and repair protein RecF Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S909 2.48e-31 124 22 5 367 3 recF DNA replication and repair protein RecF Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B4U113 3.12e-31 124 26 6 369 3 recF DNA replication and repair protein RecF Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q39ZS1 3.16e-31 124 27 9 380 3 recF DNA replication and repair protein RecF Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B2A2Y9 3.55e-31 124 25 6 379 3 recF DNA replication and repair protein RecF Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A9NE68 4.12e-31 124 25 6 338 3 recF DNA replication and repair protein RecF Acholeplasma laidlawii (strain PG-8A)
C0MBG1 4.98e-31 124 26 6 370 3 recF DNA replication and repair protein RecF Streptococcus equi subsp. equi (strain 4047)
A0AEJ1 5.17e-31 124 25 9 378 3 recF DNA replication and repair protein RecF Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9KHU6 7.85e-31 123 25 6 338 3 recF DNA replication and repair protein RecF Acholeplasma laidlawii
B9DWE6 8.17e-31 123 25 6 370 3 recF DNA replication and repair protein RecF Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C0MGR5 8.37e-31 123 26 6 369 3 recF DNA replication and repair protein RecF Streptococcus equi subsp. zooepidemicus (strain H70)
A6LPB4 8.52e-31 123 22 5 365 3 recF DNA replication and repair protein RecF Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q65PL9 1.03e-30 123 24 7 381 3 recF DNA replication and repair protein RecF Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q18C86 1.06e-30 123 24 6 368 3 recF DNA replication and repair protein RecF Clostridioides difficile (strain 630)
Q92FU8 1.2e-30 123 25 9 378 3 recF DNA replication and repair protein RecF Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B9DPX1 1.27e-30 122 24 7 374 3 recF DNA replication and repair protein RecF Staphylococcus carnosus (strain TM300)
A3CRC5 1.52e-30 122 25 7 370 3 recF DNA replication and repair protein RecF Streptococcus sanguinis (strain SK36)
Q7MX24 2e-30 122 27 10 377 3 recF DNA replication and repair protein RecF Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B3W6Q9 3.49e-30 121 25 7 375 3 recF DNA replication and repair protein RecF Lacticaseibacillus casei (strain BL23)
A8F8Y7 3.5e-30 121 24 5 373 3 recF DNA replication and repair protein RecF Bacillus pumilus (strain SAFR-032)
B2RL41 3.96e-30 121 27 10 377 3 recF DNA replication and repair protein RecF Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B8J6Y3 4.39e-30 121 26 6 373 3 recF DNA replication and repair protein RecF Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A4VYF9 5.05e-30 121 25 7 369 3 recF DNA replication and repair protein RecF Streptococcus suis (strain 05ZYH33)
A4W4P9 5.05e-30 121 25 7 369 3 recF DNA replication and repair protein RecF Streptococcus suis (strain 98HAH33)
Q9RC99 5.62e-30 121 25 6 375 3 recF DNA replication and repair protein RecF Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7H677 5.84e-30 121 27 4 368 3 recF DNA replication and repair protein RecF Anaeromyxobacter sp. (strain Fw109-5)
Q97N32 7.31e-30 120 22 5 366 3 recF DNA replication and repair protein RecF Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2YUN8 8.64e-30 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5L3Y9 1.01e-29 120 25 7 375 3 recF DNA replication and repair protein RecF Geobacillus kaustophilus (strain HTA426)
P68864 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain MW2)
P68863 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus
A8YYS7 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD86 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain MSSA476)
Q6GKU1 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain MRSA252)
P68862 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain N315)
P68861 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD43 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain Newman)
Q5HJZ2 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain COL)
A5INP5 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain JH9)
Q2G275 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain NCTC 8325 / PS 47)
A6TXF4 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain JH1)
A7WWN1 1.02e-29 120 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain Mu3 / ATCC 700698)
B1IDU6 1.11e-29 120 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Okra / Type B1)
C1FPH6 1.16e-29 120 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Kyoto / Type A2)
A7FPF3 1.16e-29 120 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain ATCC 19397 / Type A)
Q5WM28 1.31e-29 120 26 9 378 3 recF DNA replication and repair protein RecF Shouchella clausii (strain KSM-K16)
Q2S6G1 1.36e-29 120 28 6 332 3 recF DNA replication and repair protein RecF Salinibacter ruber (strain DSM 13855 / M31)
Q899S7 1.48e-29 120 23 7 371 3 recF DNA replication and repair protein RecF Clostridium tetani (strain Massachusetts / E88)
Q5L648 1.51e-29 120 25 7 369 3 recF DNA replication and repair protein RecF Chlamydia abortus (strain DSM 27085 / S26/3)
C4KZZ0 1.54e-29 120 23 5 375 3 recF DNA replication and repair protein RecF Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q03D52 1.75e-29 119 25 7 375 3 recF DNA replication and repair protein RecF Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q2FKQ2 1.87e-29 119 22 6 375 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain USA300)
Q823G6 2.07e-29 119 25 7 369 3 recF DNA replication and repair protein RecF Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
B9E903 2.23e-29 119 24 6 375 3 recF DNA replication and repair protein RecF Macrococcus caseolyticus (strain JCSC5402)
Q3A8P5 2.61e-29 119 26 9 361 3 recF DNA replication and repair protein RecF Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q890K5 3.17e-29 119 25 6 375 3 recF DNA replication and repair protein RecF Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A0L3I9 3.21e-29 119 29 6 370 3 recF DNA replication and repair protein RecF Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C3KXR0 3.85e-29 119 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain 657 / Type Ba4)
B1L1K9 3.93e-29 118 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Loch Maree / Type A3)
Q2RMJ4 4.84e-29 118 25 5 358 3 recF DNA replication and repair protein RecF Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A7Z0C6 5.09e-29 118 25 7 376 3 recF DNA replication and repair protein RecF Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B4UJV1 5.47e-29 118 26 6 373 3 recF DNA replication and repair protein RecF Anaeromyxobacter sp. (strain K)
Q8DWQ8 6.92e-29 118 24 7 372 3 recF DNA replication and repair protein RecF Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2K7 6.92e-29 118 24 7 372 3 recF DNA replication and repair protein RecF Streptococcus agalactiae serotype III (strain NEM316)
Q3JYE9 7.51e-29 118 24 7 372 3 recF DNA replication and repair protein RecF Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1MN15 8.04e-29 118 28 8 367 3 recF DNA replication and repair protein RecF Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A8AU71 1.01e-28 117 25 8 368 3 recF DNA replication and repair protein RecF Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A4IJ87 1.04e-28 117 24 5 372 3 recF DNA replication and repair protein RecF Geobacillus thermodenitrificans (strain NG80-2)
Q4LAL2 1.06e-28 117 24 9 380 3 recF DNA replication and repair protein RecF Staphylococcus haemolyticus (strain JCSC1435)
A7G9B3 1.18e-28 117 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
P05651 1.52e-28 117 23 7 379 3 recF DNA replication and repair protein RecF Bacillus subtilis (strain 168)
A6L3K9 1.64e-28 117 22 8 379 3 recF DNA replication and repair protein RecF Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A0LQR9 2.26e-28 116 27 8 379 3 recF DNA replication and repair protein RecF Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
O84077 4.05e-28 115 27 4 309 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BB61 4.05e-28 115 27 4 309 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9I2 4.05e-28 115 27 4 309 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
A8YW44 4.49e-28 115 25 8 379 3 recF DNA replication and repair protein RecF Lactobacillus helveticus (strain DPC 4571)
Q03UE1 4.73e-28 116 24 6 374 3 recF DNA replication and repair protein RecF Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B1YGB5 4.83e-28 116 25 8 376 3 recF DNA replication and repair protein RecF Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A7GJS2 5.6e-28 115 24 7 374 3 recF DNA replication and repair protein RecF Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q6HQ00 6.32e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus thuringiensis subsp. konkukian (strain 97-27)
B9IYH1 6.32e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain Q1)
B7HPS0 6.32e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain AH187)
C1ES11 6.32e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain 03BB102)
Q73FK2 6.32e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain ATCC 10987 / NRS 248)
A0R883 6.32e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus thuringiensis (strain Al Hakam)
B3PXG8 6.75e-28 115 28 8 367 3 recF DNA replication and repair protein RecF Rhizobium etli (strain CIAT 652)
Q81JD2 6.78e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HIH7 6.78e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain B4264)
Q63HG4 7.65e-28 115 24 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain ZK / E33L)
Q5FN12 7.89e-28 115 25 8 379 3 recF DNA replication and repair protein RecF Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q3KMU7 8.98e-28 115 27 4 309 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q5M237 1.01e-27 115 24 8 371 3 recF DNA replication and repair protein RecF Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q67TK4 1.22e-27 114 28 9 376 3 recF DNA replication and repair protein RecF Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B5ZWP8 1.22e-27 114 28 8 367 3 recF DNA replication and repair protein RecF Rhizobium leguminosarum bv. trifolii (strain WSM2304)
C0ZH40 1.42e-27 114 25 8 377 3 recF DNA replication and repair protein RecF Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A4T4U1 1.46e-27 114 27 8 366 3 recF DNA replication and repair protein RecF Mycolicibacterium gilvum (strain PYR-GCK)
B7JJC0 1.49e-27 114 23 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain AH820)
Q6I535 1.49e-27 114 23 6 375 3 recF DNA replication and repair protein RecF Bacillus anthracis
C3LIC5 1.49e-27 114 23 6 375 3 recF DNA replication and repair protein RecF Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8P8 1.49e-27 114 23 6 375 3 recF DNA replication and repair protein RecF Bacillus anthracis (strain A0248)
A3PSE0 2.23e-27 114 27 9 373 3 recF DNA replication and repair protein RecF Mycobacterium sp. (strain JLS)
B7IS23 2.24e-27 114 23 6 375 3 recF DNA replication and repair protein RecF Bacillus cereus (strain G9842)
Q11NR3 2.31e-27 114 24 8 369 3 recF DNA replication and repair protein RecF Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B0TAL0 3.14e-27 113 25 5 349 3 recF DNA replication and repair protein RecF Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q03I76 3.18e-27 113 24 8 371 3 recF DNA replication and repair protein RecF Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LXI7 3.18e-27 113 24 8 371 3 recF DNA replication and repair protein RecF Streptococcus thermophilus (strain CNRZ 1066)
B1HS35 3.22e-27 113 25 9 384 3 recF DNA replication and repair protein RecF Lysinibacillus sphaericus (strain C3-41)
Q38ZS1 4.76e-27 113 25 6 378 3 recF DNA replication and repair protein RecF Latilactobacillus sakei subsp. sakei (strain 23K)
Q8DRR3 5.12e-27 112 24 7 366 3 recF DNA replication and repair protein RecF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1WVP2 5.3e-27 113 25 9 376 3 recF DNA replication and repair protein RecF Ligilactobacillus salivarius (strain UCC118)
A9VM93 7.4e-27 112 23 7 375 3 recF DNA replication and repair protein RecF Bacillus mycoides (strain KBAB4)
B9JGW1 8.43e-27 112 28 8 369 3 recF DNA replication and repair protein RecF Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q1BG58 1e-26 112 27 9 373 3 recF DNA replication and repair protein RecF Mycobacterium sp. (strain MCS)
A1U8S3 1e-26 112 27 9 373 3 recF DNA replication and repair protein RecF Mycobacterium sp. (strain KMS)
B0RH73 1.71e-26 112 25 8 383 3 recF DNA replication and repair protein RecF Clavibacter sepedonicus
Q98BH1 1.89e-26 111 27 10 375 3 recF DNA replication and repair protein RecF Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C1CUE4 1.91e-26 111 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain Taiwan19F-14)
C1CNK0 1.91e-26 111 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain P1031)
Q8DMX3 1.91e-26 111 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV1 1.91e-26 111 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q1GC40 2.04e-26 111 26 9 378 3 recF DNA replication and repair protein RecF Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A5CLT6 2.24e-26 112 26 8 375 3 recF DNA replication and repair protein RecF Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
C1AJ00 2.5e-26 111 27 10 370 3 recF DNA replication and repair protein RecF Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Q7U314 2.5e-26 111 27 10 370 3 recF DNA replication and repair protein RecF Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q97N44 2.65e-26 110 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1IAD9 2.65e-26 110 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain Hungary19A-6)
B2INP4 2.68e-26 110 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain CGSP14)
A9WR32 3.12e-26 111 25 9 386 3 recF DNA replication and repair protein RecF Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A6L8H5 3.18e-26 110 23 6 376 3 recF DNA replication and repair protein RecF Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A4J0F3 3.3e-26 110 25 9 357 3 recF DNA replication and repair protein RecF Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q04CX2 4.91e-26 110 26 9 378 3 recF DNA replication and repair protein RecF Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
C1CHM6 5.25e-26 110 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain JJA)
B8ZQB8 5.25e-26 110 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CBK4 5.25e-26 110 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain 70585)
P36176 5.43e-26 110 25 10 380 3 recF DNA replication and repair protein RecF Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q89ZW6 5.61e-26 110 23 8 375 3 recF DNA replication and repair protein RecF Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q5LGW6 6.42e-26 110 24 8 375 3 recF DNA replication and repair protein RecF Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q252K0 6.47e-26 110 24 7 369 3 recF DNA replication and repair protein RecF Desulfitobacterium hafniense (strain Y51)
B8FXW8 6.47e-26 110 24 7 369 3 recF DNA replication and repair protein RecF Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q9RVE0 6.82e-26 109 28 8 361 1 recF DNA replication and repair protein RecF Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q64XR8 6.95e-26 110 24 8 375 3 recF DNA replication and repair protein RecF Bacteroides fragilis (strain YCH46)
B5E455 7.3e-26 109 22 6 368 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae serotype 19F (strain G54)
P9WHI8 7.95e-26 110 27 10 370 3 recF DNA replication and repair protein RecF Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2ILU8 9.36e-26 109 26 6 373 3 recF DNA replication and repair protein RecF Anaeromyxobacter dehalogenans (strain 2CP-C)
B3EJI1 1.2e-25 109 26 6 330 3 recF DNA replication and repair protein RecF Chlorobium phaeobacteroides (strain BS1)
A5D6E6 1.23e-25 108 26 14 379 3 recF DNA replication and repair protein RecF Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P9WHI9 1.52e-25 109 27 10 370 1 recF DNA replication and repair protein RecF Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY71 1.52e-25 109 27 10 370 3 recF DNA replication and repair protein RecF Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
B1VPF3 1.58e-25 108 26 8 363 3 recF DNA replication and repair protein RecF Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B9LH68 1.91e-25 108 27 9 392 3 recF DNA replication and repair protein RecF Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WDD4 1.91e-25 108 27 9 392 3 recF DNA replication and repair protein RecF Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A3DHZ7 1.94e-25 108 22 7 354 3 recF DNA replication and repair protein RecF Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
C4Z176 2.73e-25 108 23 7 364 3 recF DNA replication and repair protein RecF Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q3B6Y7 2.74e-25 108 26 6 331 3 recF DNA replication and repair protein RecF Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
C1B7T0 4.03e-25 108 27 8 385 3 recF DNA replication and repair protein RecF Rhodococcus opacus (strain B4)
A4SC23 4.04e-25 107 25 5 329 3 recF DNA replication and repair protein RecF Chlorobium phaeovibrioides (strain DSM 265 / 1930)
P49997 4.38e-25 107 36 4 165 3 recF DNA replication and repair protein RecF Azotobacter vinelandii
Q83N51 7.04e-25 107 24 8 367 3 recF DNA replication and repair protein RecF Tropheryma whipplei (strain Twist)
Q83NZ4 7.04e-25 107 24 8 367 3 recF DNA replication and repair protein RecF Tropheryma whipplei (strain TW08/27)
B2G4Y8 1.45e-24 106 24 7 374 3 recF DNA replication and repair protein RecF Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VHF6 1.45e-24 106 24 7 374 3 recF DNA replication and repair protein RecF Limosilactobacillus reuteri (strain DSM 20016)
Q1IXW9 1.71e-24 105 27 7 330 3 recF DNA replication and repair protein RecF Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8FUL4 1.95e-24 106 27 10 380 3 recF DNA replication and repair protein RecF Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B9JZ91 2e-24 105 27 7 372 3 recF DNA replication and repair protein RecF Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A4X0U0 2.38e-24 105 26 8 382 3 recF DNA replication and repair protein RecF Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B2GEV1 2.68e-24 105 26 11 386 3 recF DNA replication and repair protein RecF Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q1DFP6 3.05e-24 105 24 3 374 3 recF DNA replication and repair protein RecF Myxococcus xanthus (strain DK1622)
Q04HR3 3.11e-24 105 24 7 379 3 recF DNA replication and repair protein RecF Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B2HI48 4.11e-24 105 26 9 368 3 recF DNA replication and repair protein RecF Mycobacterium marinum (strain ATCC BAA-535 / M)
A2RNA8 4.68e-24 104 27 12 330 3 recF DNA replication and repair protein RecF Lactococcus lactis subsp. cremoris (strain MG1363)
A1T105 6.29e-24 104 26 9 366 3 recF DNA replication and repair protein RecF Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q0SAG4 6.43e-24 105 27 8 385 3 recF DNA replication and repair protein RecF Rhodococcus jostii (strain RHA1)
Q74M31 7.02e-24 104 24 8 377 3 recF DNA replication and repair protein RecF Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8RDL3 7.16e-24 104 23 8 356 1 recF DNA replication and repair protein RecF Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B8G3J6 8.46e-24 104 27 6 390 3 recF DNA replication and repair protein RecF Chloroflexus aggregans (strain MD-66 / DSM 9485)
P46391 9.31e-24 104 27 11 361 3 recF DNA replication and repair protein RecF Mycobacterium leprae (strain TN)
B8ZTP0 9.31e-24 104 27 11 361 3 recF DNA replication and repair protein RecF Mycobacterium leprae (strain Br4923)
Q82FD5 9.42e-24 103 25 8 361 3 recF DNA replication and repair protein RecF Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q6AHN3 1.55e-23 103 23 10 390 3 recF DNA replication and repair protein RecF Leifsonia xyli subsp. xyli (strain CTCB07)
B3EDN1 1.81e-23 103 25 6 350 3 recF DNA replication and repair protein RecF Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q2KDX0 1.92e-23 103 26 8 367 3 recF DNA replication and repair protein RecF Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q4JYF5 2.02e-23 103 24 8 412 3 recF DNA replication and repair protein RecF Corynebacterium jeikeium (strain K411)
C3PE74 2.22e-23 103 27 8 365 3 recF DNA replication and repair protein RecF Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q03I57 2.34e-23 102 23 7 376 3 recF DNA replication and repair protein RecF Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B6YRR8 4.06e-23 102 24 9 378 3 recF DNA replication and repair protein RecF Azobacteroides pseudotrichonymphae genomovar. CFP2
B7GSG2 4.37e-23 102 23 5 337 3 recF DNA replication and repair protein RecF Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q839Z2 5.47e-23 102 23 7 381 3 recF DNA replication and repair protein RecF Enterococcus faecalis (strain ATCC 700802 / V583)
Q0RUP6 6.63e-23 101 27 10 387 3 recF DNA replication and repair protein RecF Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A0PKB4 7.12e-23 101 26 9 370 3 recF DNA replication and repair protein RecF Mycobacterium ulcerans (strain Agy99)
C1CW06 7.66e-23 101 27 8 340 3 recF DNA replication and repair protein RecF Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
P56903 8.33e-23 101 26 8 373 3 recF DNA replication and repair protein RecF Rhizobium meliloti (strain 1021)
B1I1H6 1.01e-22 100 27 9 372 3 recF DNA replication and repair protein RecF Desulforudis audaxviator (strain MP104C)
A8EX95 1.24e-22 100 24 9 360 3 recF DNA replication and repair protein RecF Rickettsia canadensis (strain McKiel)
Q02WH8 1.3e-22 100 27 12 330 3 recF DNA replication and repair protein RecF Lactococcus lactis subsp. cremoris (strain SK11)
A0ZZA1 1.63e-22 100 23 5 339 3 recF DNA replication and repair protein RecF Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q8UJ65 1.83e-22 100 27 10 375 3 recF DNA replication and repair protein RecF Agrobacterium fabrum (strain C58 / ATCC 33970)
A8LVH1 1.97e-22 100 25 8 382 3 recF DNA replication and repair protein RecF Salinispora arenicola (strain CNS-205)
Q6NKL5 1.97e-22 100 25 10 380 3 recF DNA replication and repair protein RecF Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q9CE70 2.34e-22 99 26 10 327 3 recF DNA replication and repair protein RecF Lactococcus lactis subsp. lactis (strain IL1403)
P0C561 3.15e-22 99 25 8 366 3 recF DNA replication and repair protein RecF Mycolicibacterium smegmatis
A0QND8 3.15e-22 99 25 8 366 3 recF DNA replication and repair protein RecF Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q47U20 4.06e-22 99 25 9 365 3 recF DNA replication and repair protein RecF Thermobifida fusca (strain YX)
Q8G3E5 4.1e-22 99 28 12 376 3 recF DNA replication and repair protein RecF Brucella suis biovar 1 (strain 1330)
B4S937 5.13e-22 99 24 6 330 3 recF DNA replication and repair protein RecF Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A5VA37 5.17e-22 99 27 10 348 3 recF DNA replication and repair protein RecF Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
C0ZLE4 5.26e-22 99 27 10 379 3 recF DNA replication and repair protein RecF Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q047F1 6.66e-22 99 24 8 378 3 recF DNA replication and repair protein RecF Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A8GQG2 1.05e-21 98 25 10 361 3 recF DNA replication and repair protein RecF Rickettsia rickettsii (strain Sheila Smith)
B0BVU8 1.05e-21 98 25 10 361 3 recF DNA replication and repair protein RecF Rickettsia rickettsii (strain Iowa)
A4F5N5 1.81e-21 97 25 10 377 3 recF DNA replication and repair protein RecF Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q6ABL2 2.07e-21 97 24 9 376 3 recF DNA replication and repair protein RecF Cutibacterium acnes (strain DSM 16379 / KPA171202)
C4K0P8 2.32e-21 97 25 10 359 3 recF DNA replication and repair protein RecF Rickettsia peacockii (strain Rustic)
Q6M8X7 2.62e-21 97 25 12 405 3 recF DNA replication and repair protein RecF Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
C5C7X6 2.71e-21 97 27 7 369 3 recF DNA replication and repair protein RecF Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q8YED7 3.2e-21 97 28 12 376 3 recF DNA replication and repair protein RecF Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57G08 3.2e-21 97 28 12 376 3 recF DNA replication and repair protein RecF Brucella abortus biovar 1 (strain 9-941)
Q2YPM3 3.2e-21 97 28 12 376 3 recF DNA replication and repair protein RecF Brucella abortus (strain 2308)
Q92JN5 4.69e-21 96 26 11 361 3 recF DNA replication and repair protein RecF Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A6W3V7 7.74e-21 95 26 9 376 3 recF DNA replication and repair protein RecF Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
C3PM56 8.1e-21 95 25 10 359 3 recF DNA replication and repair protein RecF Rickettsia africae (strain ESF-5)
Q5Z3Z6 8.2e-21 95 24 9 369 3 recF DNA replication and repair protein RecF Nocardia farcinica (strain IFM 10152)
B3QWU7 1.35e-20 95 24 5 331 3 recF DNA replication and repair protein RecF Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A8GLV2 1.63e-20 94 25 9 357 3 recF DNA replication and repair protein RecF Rickettsia akari (strain Hartford)
A4Q9S2 2.66e-20 94 24 12 405 3 recF DNA replication and repair protein RecF Corynebacterium glutamicum (strain R)
Q4UNG8 3.61e-20 94 24 10 361 3 recF DNA replication and repair protein RecF Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B1ZSD3 4.43e-20 93 28 11 377 3 recF DNA replication and repair protein RecF Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A7NF69 1.15e-19 92 26 9 397 3 recF DNA replication and repair protein RecF Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q1RKJ9 1.5e-19 92 24 9 348 3 recF DNA replication and repair protein RecF Rickettsia bellii (strain RML369-C)
B9KZ04 2.01e-19 92 25 10 395 3 recF DNA replication and repair protein RecF Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q68XQ6 2.45e-19 91 24 10 361 3 recF DNA replication and repair protein RecF Rickettsia typhi (strain ATCC VR-144 / Wilmington)
C5BUP6 2.73e-19 91 26 8 386 3 recF DNA replication and repair protein RecF Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
A8GUF0 3.09e-19 91 24 9 348 3 recF DNA replication and repair protein RecF Rickettsia bellii (strain OSU 85-389)
Q9L7L5 3.32e-19 91 27 12 383 3 recF DNA replication and repair protein RecF Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q0B0Z2 3.79e-19 90 23 8 372 3 recF DNA replication and repair protein RecF Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A0Q8R8 6.38e-19 90 27 12 383 3 recF DNA replication and repair protein RecF Mycobacterium avium (strain 104)
B3QQY5 6.82e-19 90 24 9 354 3 recF DNA replication and repair protein RecF Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8KA81 7.3e-19 90 23 7 348 3 recF DNA replication and repair protein RecF Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A8F0D4 9.46e-19 89 24 10 359 3 recF DNA replication and repair protein RecF Rickettsia massiliae (strain Mtu5)
A0JQT5 1.3e-18 89 25 11 388 3 recF DNA replication and repair protein RecF Arthrobacter sp. (strain FB24)
B8H7D1 1.52e-18 89 24 9 395 3 recF DNA replication and repair protein RecF Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
O83049 6.16e-18 87 21 9 360 3 recF DNA replication and repair protein RecF Treponema pallidum (strain Nichols)
A1R0S5 1.68e-17 86 25 12 393 3 recF DNA replication and repair protein RecF Paenarthrobacter aurescens (strain TC1)
Q9ZEB6 1.01e-16 84 24 9 360 3 recF DNA replication and repair protein RecF Rickettsia prowazekii (strain Madrid E)
A1SCL9 1.24e-15 81 23 9 406 3 recF DNA replication and repair protein RecF Nocardioides sp. (strain ATCC BAA-499 / JS614)
A9B775 1.42e-15 80 28 10 370 3 recF DNA replication and repair protein RecF Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
B8GXP9 5.07e-14 76 26 10 364 3 recF DNA replication and repair protein RecF Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW1 5.07e-14 76 26 10 364 3 recF DNA replication and repair protein RecF Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7U4L8 6.37e-14 75 27 7 343 3 recF DNA replication and repair protein RecF Parasynechococcus marenigrum (strain WH8102)
B0CB57 2.88e-13 73 24 9 379 3 recF DNA replication and repair protein RecF Acaryochloris marina (strain MBIC 11017)
B2IVZ4 2.83e-12 70 24 7 338 3 recF DNA replication and repair protein RecF Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q8YRR9 5.09e-12 70 23 7 376 3 recF DNA replication and repair protein RecF Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3M7N8 6.47e-12 69 24 9 382 3 recF DNA replication and repair protein RecF Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B0T360 7.24e-12 69 25 10 357 3 recF DNA replication and repair protein RecF Caulobacter sp. (strain K31)
Q7NHY0 8.17e-12 69 25 9 386 3 recF DNA replication and repair protein RecF Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q114T6 2.55e-11 67 21 5 317 3 recF DNA replication and repair protein RecF Trichodesmium erythraeum (strain IMS101)
Q3AML2 3.01e-11 67 27 10 353 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain CC9605)
B1WT39 5.33e-11 67 21 6 387 3 recF DNA replication and repair protein RecF Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q8DG79 9.51e-11 66 25 7 335 3 recF DNA replication and repair protein RecF Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P73532 2.54e-10 64 24 9 337 3 recF DNA replication and repair protein RecF Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B0JM53 3.37e-10 64 23 9 385 3 recF DNA replication and repair protein RecF Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B7KID4 2.19e-09 62 22 6 340 3 recF DNA replication and repair protein RecF Gloeothece citriformis (strain PCC 7424)
B1XJ90 2.43e-09 62 22 8 383 3 recF DNA replication and repair protein RecF Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q2JQG8 4.03e-09 61 23 7 334 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain JA-3-3Ab)
B7K127 1.46e-08 59 24 9 386 3 recF DNA replication and repair protein RecF Rippkaea orientalis (strain PCC 8801 / RF-1)
Q2JIB8 1.77e-08 59 23 4 322 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain JA-2-3B'a(2-13))
Q5N0Y2 2.95e-07 55 23 8 378 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31KY9 4.91e-07 54 23 8 378 3 recF DNA replication and repair protein RecF Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B8HVF7 1.48e-06 53 24 8 335 3 recF DNA replication and repair protein RecF Cyanothece sp. (strain PCC 7425 / ATCC 29141)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15575
Feature type CDS
Gene recF
Product DNA replication/repair protein RecF
Location 44878 - 45960 (strand: -1)
Length 1083 (nucleotides) / 360 (amino acids)

Contig

Accession contig_21
Length 81362 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2081
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02463 RecF/RecN/SMC N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1195 Replication, recombination and repair (L) L Recombinational DNA repair ATPase RecF

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03629 DNA replication and repair protein RecF Homologous recombination -

Protein Sequence

MILSRLLIRDFRNIENADLPLATGFNFLVGPNGSGKTSVLEAIYTLGHGRAFRSVQAGRVIRHDNDEFILHGKLGQEQTDRATSVGLSKNRQGDSKVRIDGTDGHKIAELAKLLPMQLITPEGFTLLNGGPKFRRAYIDWGCFHNEPQFFALWSDLKRLVRQRNAALRQVSNYGQIRHWDQQLIPVAEQVSQWRENYVTAIAQDIEQTCQQFLPEFSLSVSFQRGWDKETDYSELLQRQFERDRALTYTASGPHKADLRIRADGVPVEDLLSRGQLKLLMCALRLAQGEYFTRQSGQQCLYLLDDFASELDAGRRLLLAHRLKATQAQVFVSAITPEQVSDMADENSRLFVVEKGKIQVQ

Flanking regions ( +/- flanking 50bp)

CGCCAGTGATGCAGCCGCTTACGTTGTGATGCCGATGCGCCTGTAACACGATGATCCTCTCGCGTTTACTTATCCGTGATTTTCGCAATATCGAAAATGCGGATTTACCGCTGGCCACCGGGTTTAACTTTCTGGTCGGCCCGAACGGCAGCGGTAAAACCAGTGTTCTGGAAGCCATTTACACACTCGGCCACGGCCGGGCATTCCGCTCAGTACAGGCGGGGCGTGTTATCCGCCATGATAACGACGAATTTATCCTGCACGGCAAACTCGGGCAGGAACAGACAGACCGGGCCACCAGCGTCGGCCTGAGTAAAAACCGCCAGGGTGACAGCAAGGTCCGCATTGACGGCACTGACGGCCATAAAATTGCCGAGCTGGCAAAATTACTGCCGATGCAGCTTATCACCCCGGAAGGCTTTACCCTGCTCAACGGCGGGCCGAAATTCCGCCGGGCTTATATTGACTGGGGCTGTTTCCACAATGAACCGCAATTTTTTGCGCTGTGGAGTGATTTAAAACGTCTGGTGAGACAGCGCAATGCCGCCCTCCGCCAGGTATCGAATTACGGTCAGATCCGCCACTGGGATCAGCAGCTGATTCCGGTTGCTGAGCAGGTCAGTCAGTGGCGGGAGAATTATGTGACAGCGATTGCTCAGGATATTGAGCAGACCTGTCAGCAGTTTTTACCTGAATTTTCGCTGAGTGTCTCTTTCCAGCGCGGATGGGATAAAGAGACCGATTATTCAGAGCTTCTGCAGCGCCAGTTTGAACGGGACCGCGCACTGACCTACACCGCCTCCGGCCCGCATAAAGCGGATTTACGGATCAGAGCGGACGGGGTGCCGGTGGAAGATTTACTTTCACGTGGTCAGTTAAAACTGCTGATGTGCGCGCTGCGGTTAGCACAGGGTGAATATTTCACCCGTCAGAGCGGGCAGCAATGCCTGTATCTGCTTGATGATTTTGCCTCCGAACTGGATGCCGGGCGCCGTCTTTTACTGGCTCACCGGCTGAAAGCCACACAGGCACAGGTTTTTGTCAGTGCCATCACCCCTGAACAGGTCAGTGATATGGCGGATGAAAACAGTCGCCTCTTTGTCGTGGAAAAAGGTAAAATACAGGTTCAATAATCAGGATTAGATGAGCGGGAAACGTTGATGTCGAATACCTATGACTCCTC