Homologs in group_2120

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15575 FBDBKF_15575 94.7 Morganella morganii S1 recF DNA replication/repair protein RecF
EHELCC_15935 EHELCC_15935 94.7 Morganella morganii S2 recF DNA replication/repair protein RecF
NLDBIP_16435 NLDBIP_16435 94.7 Morganella morganii S4 recF DNA replication/repair protein RecF
LHKJJB_16370 LHKJJB_16370 94.7 Morganella morganii S3 recF DNA replication/repair protein RecF
HKOGLL_16140 HKOGLL_16140 94.7 Morganella morganii S5 recF DNA replication/repair protein RecF
PMI_RS15510 PMI_RS15510 76.4 Proteus mirabilis HI4320 recF DNA replication/repair protein RecF

Distribution of the homologs in the orthogroup group_2120

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2120

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7NAD1 0.0 607 78 0 360 3 recF DNA replication and repair protein RecF Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G7Q4 0.0 595 78 1 360 3 recF DNA replication and repair protein RecF Serratia proteamaculans (strain 568)
A7FPB5 0.0 593 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JGD5 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663T4 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R5R3 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9U9 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia pestis
A1JT78 0.0 592 77 1 360 3 recF DNA replication and repair protein RecF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2JYI8 0.0 590 76 1 360 3 recF DNA replication and repair protein RecF Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P24900 0.0 582 76 1 357 3 recF DNA replication and repair protein RecF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z2N4 0.0 582 76 1 357 3 recF DNA replication and repair protein RecF Salmonella typhi
B4SYA6 0.0 582 76 1 357 3 recF DNA replication and repair protein RecF Salmonella newport (strain SL254)
B4TAU7 0.0 582 76 1 357 3 recF DNA replication and repair protein RecF Salmonella heidelberg (strain SL476)
C0Q2K7 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi C (strain RKS4594)
B5RFY9 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUP8 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella enteritidis PT4 (strain P125109)
B5FN08 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella dublin (strain CT_02021853)
Q57I02 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella choleraesuis (strain SC-B67)
B5EYB2 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella agona (strain SL483)
B2VCE1 0.0 580 75 1 360 3 recF DNA replication and repair protein RecF Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A9MX74 0.0 580 76 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5BIL2 0.0 578 76 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi A (strain AKU_12601)
Q5PKU8 0.0 578 76 1 357 3 recF DNA replication and repair protein RecF Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MJU2 0.0 578 76 1 357 3 recF DNA replication and repair protein RecF Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4TN05 0.0 578 76 1 357 3 recF DNA replication and repair protein RecF Salmonella schwarzengrund (strain CVM19633)
P22839 0.0 578 76 1 361 3 recF DNA replication and repair protein RecF Proteus mirabilis
B4F0U7 0.0 578 76 1 361 3 recF DNA replication and repair protein RecF Proteus mirabilis (strain HI4320)
Q7BZ80 0.0 577 75 1 357 3 recF DNA replication and repair protein RecF Shigella flexneri
Q3YWB4 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Shigella sonnei (strain Ss046)
Q1R4N7 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain UTI89 / UPEC)
B1LL25 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain SMS-3-5 / SECEC)
B6I3T3 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain SE11)
B7NF17 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7H0 0.0 576 75 1 357 1 recF DNA replication and repair protein RecF Escherichia coli (strain K12)
B1IYP4 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7H1 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AHN5 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O1:K1 / APEC
A8A6G1 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O9:H4 (strain HS)
B1X9S9 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain K12 / DH10B)
C4ZYX7 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4I9 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O8 (strain IAI1)
B7N204 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O81 (strain ED1a)
B5YXA2 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7H2 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O157:H7
B7L842 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli (strain 55989 / EAEC)
B7MGC1 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMG7 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTQ6 0.0 576 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LK42 0.0 575 75 1 357 3 recF DNA replication and repair protein RecF Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4W4R3 0.0 575 74 1 357 3 recF DNA replication and repair protein RecF Enterobacter sp. (strain 638)
Q0TB07 0.0 575 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NR02 0.0 575 75 1 357 3 recF DNA replication and repair protein RecF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A8ACL2 0.0 575 75 1 357 3 recF DNA replication and repair protein RecF Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q0SYP0 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Shigella flexneri serotype 5b (strain 8401)
B2TUS8 0.0 573 75 1 357 3 recF DNA replication and repair protein RecF Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
C6DGH9 0.0 573 74 1 360 3 recF DNA replication and repair protein RecF Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q31UV3 0.0 572 75 1 357 3 recF DNA replication and repair protein RecF Shigella boydii serotype 4 (strain Sb227)
B5XT53 0.0 572 75 1 357 3 recF DNA replication and repair protein RecF Klebsiella pneumoniae (strain 342)
A6TG02 0.0 570 74 1 357 3 recF DNA replication and repair protein RecF Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6CYR6 0.0 569 74 1 360 3 recF DNA replication and repair protein RecF Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q329B8 0.0 568 74 1 357 3 recF DNA replication and repair protein RecF Shigella dysenteriae serotype 1 (strain Sd197)
C5BHC7 0.0 565 73 1 359 3 recF DNA replication and repair protein RecF Edwardsiella ictaluri (strain 93-146)
A7MMZ8 0.0 562 73 1 357 3 recF DNA replication and repair protein RecF Cronobacter sakazakii (strain ATCC BAA-894)
Q2NX47 0.0 561 74 1 361 3 recF DNA replication and repair protein RecF Sodalis glossinidius (strain morsitans)
Q6YI30 0.0 560 74 1 361 3 recF DNA replication and repair protein RecF Sodalis glossinidius
B6EP48 5.88e-157 447 57 1 357 3 recF DNA replication and repair protein RecF Aliivibrio salmonicida (strain LFI1238)
Q5E8Z0 1.29e-154 441 55 1 357 3 recF DNA replication and repair protein RecF Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FEV5 4.58e-154 440 55 1 357 3 recF DNA replication and repair protein RecF Aliivibrio fischeri (strain MJ11)
B7VGI6 6.15e-154 440 55 1 358 3 recF DNA replication and repair protein RecF Vibrio atlanticus (strain LGP32)
Q0I0Y5 1.16e-153 439 57 1 358 3 recF DNA replication and repair protein RecF Histophilus somni (strain 129Pt)
B0UUM0 1.62e-153 439 57 1 358 3 recF DNA replication and repair protein RecF Histophilus somni (strain 2336)
Q65VB6 5.17e-151 432 55 2 359 3 recF DNA replication and repair protein RecF Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7MQJ5 8.53e-151 432 55 2 359 3 recF DNA replication and repair protein RecF Vibrio vulnificus (strain YJ016)
Q87TQ5 1.15e-150 431 56 2 359 3 recF DNA replication and repair protein RecF Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DDJ1 4.54e-150 430 55 2 359 3 recF DNA replication and repair protein RecF Vibrio vulnificus (strain CMCP6)
P43767 1.5e-149 429 56 1 357 3 recF DNA replication and repair protein RecF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLR9 4.41e-149 427 57 1 357 3 recF DNA replication and repair protein RecF Haemophilus influenzae (strain 86-028NP)
A7N1F1 5.01e-149 427 55 2 359 3 recF DNA replication and repair protein RecF Vibrio campbellii (strain ATCC BAA-1116)
Q9CLQ6 6.31e-149 427 59 2 357 3 recF DNA replication and repair protein RecF Pasteurella multocida (strain Pm70)
Q7VMW3 6.99e-149 427 55 2 362 3 recF DNA replication and repair protein RecF Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A3MY75 1.17e-148 426 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BRG1 3.89e-148 425 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
C3LP87 7.53e-148 424 55 1 361 3 recF DNA replication and repair protein RecF Vibrio cholerae serotype O1 (strain M66-2)
Q9KVX4 7.53e-148 424 55 1 361 3 recF DNA replication and repair protein RecF Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F493 7.53e-148 424 55 1 361 3 recF DNA replication and repair protein RecF Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B3GZJ3 1.24e-147 424 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
P24718 1.56e-147 424 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus pleuropneumoniae
A6VK88 1.1e-145 419 55 2 360 3 recF DNA replication and repair protein RecF Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F744 4.19e-145 417 56 2 361 3 recF DNA replication and repair protein RecF Glaesserella parasuis serovar 5 (strain SH0165)
Q12TC6 8.92e-124 363 48 2 360 3 recF DNA replication and repair protein RecF Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8E3P6 9.24e-121 355 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS223)
A9KU74 1.7e-120 355 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS195)
A3CYH7 1.7e-120 355 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q0I0U6 5.29e-120 353 48 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain MR-7)
Q0HPD2 5.77e-120 353 48 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain MR-4)
A6WH87 9.52e-120 353 48 2 360 3 recF DNA replication and repair protein RecF Shewanella baltica (strain OS185)
A8GYE5 1.03e-119 353 47 2 360 3 recF DNA replication and repair protein RecF Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A0KR37 2.16e-119 352 47 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain ANA-3)
Q8EKT0 1.64e-118 350 48 2 360 3 recF DNA replication and repair protein RecF Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4Y1A6 3.39e-118 349 47 2 360 3 recF DNA replication and repair protein RecF Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RDX9 7.44e-118 348 47 2 360 3 recF DNA replication and repair protein RecF Shewanella sp. (strain W3-18-1)
B8CH73 7.17e-117 345 46 2 360 3 recF DNA replication and repair protein RecF Shewanella piezotolerans (strain WP3 / JCM 13877)
A1T0X6 1.47e-116 345 45 2 361 3 recF DNA replication and repair protein RecF Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B0TLA6 2.77e-116 344 46 2 360 3 recF DNA replication and repair protein RecF Shewanella halifaxensis (strain HAW-EB4)
B1KCX5 1.84e-115 342 46 2 360 3 recF DNA replication and repair protein RecF Shewanella woodyi (strain ATCC 51908 / MS32)
A3Q8S8 1.73e-114 340 46 2 360 3 recF DNA replication and repair protein RecF Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8FP48 2.89e-114 339 46 2 360 3 recF DNA replication and repair protein RecF Shewanella sediminis (strain HAW-EB3)
Q08A49 9.58e-114 338 46 2 360 3 recF DNA replication and repair protein RecF Shewanella frigidimarina (strain NCIMB 400)
A1S1H1 3.74e-113 336 47 3 359 3 recF DNA replication and repair protein RecF Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B7V0N8 2.09e-91 281 40 4 361 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain LESB58)
Q9I7C3 3.05e-91 281 40 4 361 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02V78 3.05e-91 281 40 4 361 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain UCBPP-PA14)
Q500U5 7.7e-91 280 40 3 360 3 recF DNA replication and repair protein RecF Pseudomonas syringae pv. syringae (strain B728a)
A6UX64 9.63e-91 279 40 4 361 3 recF DNA replication and repair protein RecF Pseudomonas aeruginosa (strain PA7)
B1J3Y4 1.77e-90 278 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain W619)
Q1IH46 2.43e-90 278 40 5 362 3 recF DNA replication and repair protein RecF Pseudomonas entomophila (strain L48)
Q88BK1 3.74e-90 278 40 3 360 3 recF DNA replication and repair protein RecF Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88RW7 1.34e-89 276 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VWC0 1.58e-89 276 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3KKF9 1.92e-89 276 39 4 361 3 recF DNA replication and repair protein RecF Pseudomonas fluorescens (strain Pf0-1)
C3KDU4 2.19e-89 276 40 3 360 3 recF DNA replication and repair protein RecF Pseudomonas fluorescens (strain SBW25)
B0KEV1 4.33e-89 275 39 4 361 3 recF DNA replication and repair protein RecF Pseudomonas putida (strain GB-1)
A4XN62 4.62e-89 275 40 4 361 3 recF DNA replication and repair protein RecF Pseudomonas mendocina (strain ymp)
Q4KKS8 4.93e-89 275 40 3 360 3 recF DNA replication and repair protein RecF Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48QJ8 7.44e-89 275 39 3 360 3 recF DNA replication and repair protein RecF Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0BL82 7.48e-87 269 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. holarctica (strain OSU18)
Q2A2N7 7.48e-87 269 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. holarctica (strain LVS)
A7ND52 7.48e-87 269 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q3IDE8 7.95e-87 269 40 5 327 3 recF DNA replication and repair protein RecF Pseudoalteromonas translucida (strain TAC 125)
B3PEM4 1.05e-86 269 38 3 362 3 recF DNA replication and repair protein RecF Cellvibrio japonicus (strain Ueda107)
B2SG84 1.09e-86 268 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. mediasiatica (strain FSC147)
A4IXB4 1.82e-86 268 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGS0 1.82e-86 268 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14I72 1.82e-86 268 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. tularensis (strain FSC 198)
A0Q5W0 2.96e-86 267 38 3 351 3 recF DNA replication and repair protein RecF Francisella tularensis subsp. novicida (strain U112)
C1DFU4 1.95e-85 266 39 5 361 3 recF DNA replication and repair protein RecF Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q5QY37 1.34e-84 263 37 2 358 3 recF DNA replication and repair protein RecF Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q15ZZ5 1.9e-84 263 37 4 362 3 recF DNA replication and repair protein RecF Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A4VFG0 5.77e-84 262 39 4 361 3 recF DNA replication and repair protein RecF Stutzerimonas stutzeri (strain A1501)
B0U178 3.26e-83 259 36 3 350 3 recF DNA replication and repair protein RecF Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
P13456 1e-81 256 38 5 360 3 recF DNA replication and repair protein RecF Pseudomonas putida
Q1R1P0 3.25e-81 254 36 4 361 3 recF DNA replication and repair protein RecF Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B6J8S5 2.72e-79 249 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain CbuK_Q154)
Q83FD6 3.34e-79 249 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N902 3.34e-79 249 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J289 4.1e-79 249 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain CbuG_Q212)
A9KEV0 1.04e-78 248 36 2 355 3 recF DNA replication and repair protein RecF Coxiella burnetii (strain Dugway 5J108-111)
A6VR67 1.13e-74 238 38 3 338 3 recF DNA replication and repair protein RecF Marinomonas sp. (strain MWYL1)
Q31JS3 8.58e-74 236 34 5 361 3 recF DNA replication and repair protein RecF Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C5BKM1 9.63e-74 236 37 6 369 3 recF DNA replication and repair protein RecF Teredinibacter turnerae (strain ATCC 39867 / T7901)
B8GSS3 1.27e-73 235 36 3 360 3 recF DNA replication and repair protein RecF Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q21PV3 2.88e-72 232 36 6 365 3 recF DNA replication and repair protein RecF Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2SQZ4 9.06e-69 223 31 5 370 3 recF DNA replication and repair protein RecF Hahella chejuensis (strain KCTC 2396)
Q3JF36 9.42e-65 212 34 3 362 3 recF DNA replication and repair protein RecF Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q602N2 3.95e-64 211 37 4 361 3 recF DNA replication and repair protein RecF Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1TWJ3 1.47e-63 209 35 8 371 3 recF DNA replication and repair protein RecF Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8PEH3 1.81e-60 201 34 6 363 3 recF DNA replication and repair protein RecF Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4V0S6 1.81e-60 201 34 6 363 3 recF DNA replication and repair protein RecF Xanthomonas campestris pv. campestris (strain 8004)
Q48AS5 4.71e-60 201 32 3 337 3 recF DNA replication and repair protein RecF Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B2FT82 1.53e-58 196 33 6 363 3 recF DNA replication and repair protein RecF Stenotrophomonas maltophilia (strain K279a)
Q5H713 2.39e-57 193 34 7 367 3 recF DNA replication and repair protein RecF Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q6FG19 3.97e-57 192 32 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8PRG0 9.55e-57 192 34 7 366 3 recF DNA replication and repair protein RecF Xanthomonas axonopodis pv. citri (strain 306)
A3M0Q6 1.46e-56 191 32 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VAF5 1.55e-56 191 32 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain AYE)
B2HZA5 1.55e-56 191 32 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain ACICU)
B7IBH5 1.55e-56 191 32 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain AB0057)
B7GUX7 1.55e-56 191 32 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain AB307-0294)
B4SR07 2.06e-56 191 33 6 363 3 recF DNA replication and repair protein RecF Stenotrophomonas maltophilia (strain R551-3)
Q2P9L9 4.75e-56 190 34 7 364 3 recF DNA replication and repair protein RecF Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B0VMK2 5.18e-56 189 32 5 364 3 recF DNA replication and repair protein RecF Acinetobacter baumannii (strain SDF)
Q3BZS9 1.02e-55 189 33 6 366 3 recF DNA replication and repair protein RecF Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q9PHE1 1.11e-54 186 33 5 363 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain 9a5c)
Q87FC4 4.01e-54 185 33 4 361 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5U9 4.01e-54 185 33 4 361 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain M23)
B0U1G7 7.83e-54 184 34 6 364 3 recF DNA replication and repair protein RecF Xylella fastidiosa (strain M12)
A8MEA3 8.99e-43 155 27 6 372 3 recF DNA replication and repair protein RecF Alkaliphilus oremlandii (strain OhILAs)
B3E8N9 1.98e-42 154 28 5 364 3 recF DNA replication and repair protein RecF Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B9M7S3 4.32e-42 153 26 6 367 3 recF DNA replication and repair protein RecF Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B5E7P8 1.79e-41 152 28 6 370 3 recF DNA replication and repair protein RecF Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6E7Q7 6.29e-41 150 28 5 366 3 recF DNA replication and repair protein RecF Geobacter sp. (strain M21)
A5GDX3 1.14e-39 147 26 5 366 3 recF DNA replication and repair protein RecF Geotalea uraniireducens (strain Rf4)
B8I3R5 5.45e-39 145 26 7 374 3 recF DNA replication and repair protein RecF Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A5FNH5 9.43e-38 142 28 7 351 3 recF DNA replication and repair protein RecF Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q6MAG9 1.71e-37 141 28 9 360 3 recF DNA replication and repair protein RecF Protochlamydia amoebophila (strain UWE25)
A6H141 7.52e-37 139 25 9 367 3 recF DNA replication and repair protein RecF Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q056V0 4.83e-36 137 26 4 363 3 recF DNA replication and repair protein RecF Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04WF5 4.83e-36 137 26 4 363 3 recF DNA replication and repair protein RecF Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B0KAG3 2.9e-35 135 25 6 351 3 recF DNA replication and repair protein RecF Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K0X1 2.93e-35 135 25 6 351 3 recF DNA replication and repair protein RecF Thermoanaerobacter sp. (strain X514)
Q3A8M6 4.02e-35 135 28 4 363 3 recF DNA replication and repair protein RecF Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q4A177 4.41e-35 135 25 5 375 3 recF DNA replication and repair protein RecF Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CQK5 5.3e-35 134 25 5 375 3 recF DNA replication and repair protein RecF Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q72WD4 7.76e-35 134 26 4 363 3 recF DNA replication and repair protein RecF Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B8CZN7 8.28e-35 134 25 8 376 3 recF DNA replication and repair protein RecF Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A9KPP4 1.11e-34 133 25 5 363 3 recF DNA replication and repair protein RecF Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A7H677 1.57e-34 133 27 4 368 3 recF DNA replication and repair protein RecF Anaeromyxobacter sp. (strain Fw109-5)
Q254F3 2.31e-34 132 27 7 369 3 recF DNA replication and repair protein RecF Chlamydia felis (strain Fe/C-56)
Q74H90 2.46e-34 132 29 7 345 3 recF DNA replication and repair protein RecF Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5HK02 2.81e-34 132 25 5 375 3 recF DNA replication and repair protein RecF Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q040E6 3e-34 132 26 6 377 3 recF DNA replication and repair protein RecF Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8FA32 3.87e-34 132 25 4 363 3 recF DNA replication and repair protein RecF Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
B8J6Y3 4.89e-34 132 27 5 372 3 recF DNA replication and repair protein RecF Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q8EU85 5.4e-34 132 25 8 378 3 recF DNA replication and repair protein RecF Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B5XJC1 7.28e-34 131 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M49 (strain NZ131)
Q9PKW5 7.4e-34 131 26 5 368 3 recF DNA replication and repair protein RecF Chlamydia muridarum (strain MoPn / Nigg)
Q1JEB8 7.83e-34 131 27 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8NYZ4 7.83e-34 131 27 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M18 (strain MGAS8232)
A0Q3U3 8.1e-34 131 23 5 366 3 recF DNA replication and repair protein RecF Clostridium novyi (strain NT)
A6TJ79 1.26e-33 130 26 7 377 3 recF DNA replication and repair protein RecF Alkaliphilus metalliredigens (strain QYMF)
Q5X9A5 1.29e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q18C86 1.31e-33 130 25 6 368 3 recF DNA replication and repair protein RecF Clostridioides difficile (strain 630)
C5D330 1.63e-33 130 25 7 375 3 recF DNA replication and repair protein RecF Geobacillus sp. (strain WCH70)
Q9RC99 1.66e-33 130 26 5 373 3 recF DNA replication and repair protein RecF Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0DD85 2.37e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD84 2.37e-33 130 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B1MW32 2.59e-33 130 27 7 377 3 recF DNA replication and repair protein RecF Leuconostoc citreum (strain KM20)
B9DPX1 3.12e-33 130 25 7 374 3 recF DNA replication and repair protein RecF Staphylococcus carnosus (strain TM300)
Q48QL2 3.65e-33 129 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J973 3.65e-33 129 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0C0D1 4.01e-33 129 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M1
Q1J443 4.3e-33 129 27 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJC0 7.26e-33 129 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M12 (strain MGAS9429)
A2RH21 7.64e-33 129 26 8 369 3 recF DNA replication and repair protein RecF Streptococcus pyogenes serotype M5 (strain Manfredo)
B8DAQ5 9.92e-33 128 25 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serotype 4a (strain HCC23)
Q8YAV8 1.04e-32 128 25 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q725G6 1.04e-32 128 25 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serotype 4b (strain F2365)
C1L302 1.04e-32 128 25 8 377 3 recF DNA replication and repair protein RecF Listeria monocytogenes serotype 4b (strain CLIP80459)
B2UX46 1.48e-32 127 22 5 365 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Alaska E43 / Type E3)
Q65PL9 2.12e-32 127 25 7 381 3 recF DNA replication and repair protein RecF Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B2THB7 2.21e-32 127 22 5 365 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Eklund 17B / Type B)
A0AEJ1 3.75e-32 127 25 8 377 3 recF DNA replication and repair protein RecF Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B4U113 5.49e-32 126 27 6 369 3 recF DNA replication and repair protein RecF Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
B9E903 5.61e-32 126 25 7 376 3 recF DNA replication and repair protein RecF Macrococcus caseolyticus (strain JCSC5402)
Q92FU8 8.24e-32 126 25 8 377 3 recF DNA replication and repair protein RecF Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q890K5 8.74e-32 126 27 5 351 3 recF DNA replication and repair protein RecF Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B0SK33 9.79e-32 125 23 6 368 3 recF DNA replication and repair protein RecF Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S909 9.79e-32 125 23 6 368 3 recF DNA replication and repair protein RecF Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
C0MBG1 1.08e-31 125 27 6 370 3 recF DNA replication and repair protein RecF Streptococcus equi subsp. equi (strain 4047)
B4UJV1 1.14e-31 125 26 5 372 3 recF DNA replication and repair protein RecF Anaeromyxobacter sp. (strain K)
Q5L648 1.19e-31 125 26 8 370 3 recF DNA replication and repair protein RecF Chlamydia abortus (strain DSM 27085 / S26/3)
Q2YUN8 1.55e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain bovine RF122 / ET3-1)
P68864 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain MW2)
P68863 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus
A8YYS7 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD86 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain MSSA476)
Q6GKU1 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain MRSA252)
P68862 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain N315)
P68861 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD43 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain Newman)
Q5HJZ2 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain COL)
A5INP5 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain JH9)
Q2G275 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain NCTC 8325 / PS 47)
A6TXF4 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain JH1)
A7WWN1 1.63e-31 125 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain Mu3 / ATCC 700698)
C0MGR5 1.74e-31 125 27 6 369 3 recF DNA replication and repair protein RecF Streptococcus equi subsp. zooepidemicus (strain H70)
Q7MX24 1.8e-31 125 27 8 374 3 recF DNA replication and repair protein RecF Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B3W6Q9 2.1e-31 125 26 7 375 3 recF DNA replication and repair protein RecF Lacticaseibacillus casei (strain BL23)
A5N460 2.1e-31 125 23 6 367 3 recF DNA replication and repair protein RecF Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
C4Z940 2.37e-31 124 25 6 369 3 recF DNA replication and repair protein RecF Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q03D52 2.55e-31 124 27 9 381 3 recF DNA replication and repair protein RecF Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B9DWE6 2.86e-31 124 26 6 370 3 recF DNA replication and repair protein RecF Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A8F8Y7 2.95e-31 124 25 5 376 3 recF DNA replication and repair protein RecF Bacillus pumilus (strain SAFR-032)
Q2FKQ2 3.37e-31 124 24 7 378 3 recF DNA replication and repair protein RecF Staphylococcus aureus (strain USA300)
Q39ZS1 3.46e-31 124 27 9 380 3 recF DNA replication and repair protein RecF Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B2RL41 3.8e-31 124 27 8 374 3 recF DNA replication and repair protein RecF Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q823G6 4.57e-31 124 26 7 369 3 recF DNA replication and repair protein RecF Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A9NE68 4.9e-31 123 26 7 342 3 recF DNA replication and repair protein RecF Acholeplasma laidlawii (strain PG-8A)
Q5WM28 5.35e-31 124 26 9 381 3 recF DNA replication and repair protein RecF Shouchella clausii (strain KSM-K16)
Q3A8P5 5.72e-31 123 26 10 363 3 recF DNA replication and repair protein RecF Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B2A2Y9 5.72e-31 124 24 5 377 3 recF DNA replication and repair protein RecF Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q4LAL2 6.32e-31 124 25 8 379 3 recF DNA replication and repair protein RecF Staphylococcus haemolyticus (strain JCSC1435)
Q9KHU6 6.66e-31 123 26 7 342 3 recF DNA replication and repair protein RecF Acholeplasma laidlawii
A4VYF9 7.01e-31 123 25 7 369 3 recF DNA replication and repair protein RecF Streptococcus suis (strain 05ZYH33)
A4W4P9 7.01e-31 123 25 7 369 3 recF DNA replication and repair protein RecF Streptococcus suis (strain 98HAH33)
A0LZH4 9.97e-31 123 25 12 375 3 recF DNA replication and repair protein RecF Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q5L3Y9 1.21e-30 123 25 6 375 3 recF DNA replication and repair protein RecF Geobacillus kaustophilus (strain HTA426)
Q899S7 1.28e-30 122 23 6 369 3 recF DNA replication and repair protein RecF Clostridium tetani (strain Massachusetts / E88)
Q03UE1 1.76e-30 122 25 6 374 3 recF DNA replication and repair protein RecF Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A7GJS2 2.08e-30 122 24 5 371 3 recF DNA replication and repair protein RecF Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A7Z0C6 2.19e-30 122 26 7 376 3 recF DNA replication and repair protein RecF Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q0SWY1 2.22e-30 122 24 5 366 3 recF DNA replication and repair protein RecF Clostridium perfringens (strain SM101 / Type A)
Q8XPF9 2.22e-30 122 24 5 366 3 recF DNA replication and repair protein RecF Clostridium perfringens (strain 13 / Type A)
Q0TV61 2.22e-30 122 24 5 366 3 recF DNA replication and repair protein RecF Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A6LPB4 2.61e-30 122 21 5 365 3 recF DNA replication and repair protein RecF Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A3CRC5 2.77e-30 122 25 9 372 3 recF DNA replication and repair protein RecF Streptococcus sanguinis (strain SK36)
Q6HQ00 2.83e-30 122 24 5 373 3 recF DNA replication and repair protein RecF Bacillus thuringiensis subsp. konkukian (strain 97-27)
B9IYH1 2.83e-30 122 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain Q1)
B7HPS0 2.83e-30 122 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain AH187)
C1ES11 2.83e-30 122 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain 03BB102)
Q73FK2 2.83e-30 122 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain ATCC 10987 / NRS 248)
A0R883 2.83e-30 122 24 5 373 3 recF DNA replication and repair protein RecF Bacillus thuringiensis (strain Al Hakam)
P05651 2.95e-30 122 24 7 379 3 recF DNA replication and repair protein RecF Bacillus subtilis (strain 168)
Q2ILU8 2.95e-30 122 27 6 373 3 recF DNA replication and repair protein RecF Anaeromyxobacter dehalogenans (strain 2CP-C)
C4KZZ0 3.65e-30 121 23 5 375 3 recF DNA replication and repair protein RecF Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B7IS23 3.92e-30 121 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain G9842)
A8AU71 4.34e-30 121 25 8 368 3 recF DNA replication and repair protein RecF Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q2RMJ4 5.47e-30 121 25 5 358 3 recF DNA replication and repair protein RecF Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B7JJC0 7.13e-30 120 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain AH820)
Q6I535 7.13e-30 120 24 5 373 3 recF DNA replication and repair protein RecF Bacillus anthracis
C3LIC5 7.13e-30 120 24 5 373 3 recF DNA replication and repair protein RecF Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8P8 7.13e-30 120 24 5 373 3 recF DNA replication and repair protein RecF Bacillus anthracis (strain A0248)
A4IJ87 1.21e-29 120 25 6 374 3 recF DNA replication and repair protein RecF Geobacillus thermodenitrificans (strain NG80-2)
A0L3I9 1.58e-29 120 29 8 374 3 recF DNA replication and repair protein RecF Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q81JD2 1.79e-29 119 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HIH7 1.79e-29 119 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain B4264)
B1IDU6 2.29e-29 119 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Okra / Type B1)
A4J0F3 2.3e-29 119 26 9 357 3 recF DNA replication and repair protein RecF Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q63HG4 2.35e-29 119 24 5 373 3 recF DNA replication and repair protein RecF Bacillus cereus (strain ZK / E33L)
C1FPH6 2.93e-29 119 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Kyoto / Type A2)
A7FPF3 2.93e-29 119 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain ATCC 19397 / Type A)
Q8DWQ8 3.62e-29 119 25 9 373 3 recF DNA replication and repair protein RecF Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2K7 3.62e-29 119 25 9 373 3 recF DNA replication and repair protein RecF Streptococcus agalactiae serotype III (strain NEM316)
Q3JYE9 3.77e-29 119 25 9 373 3 recF DNA replication and repair protein RecF Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B1YGB5 4.91e-29 119 25 8 374 3 recF DNA replication and repair protein RecF Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q2S6G1 5.47e-29 119 27 6 332 3 recF DNA replication and repair protein RecF Salinibacter ruber (strain DSM 13855 / M31)
A4SC23 5.78e-29 118 27 5 329 3 recF DNA replication and repair protein RecF Chlorobium phaeovibrioides (strain DSM 265 / 1930)
O84077 9.93e-29 117 27 4 309 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BB61 9.93e-29 117 27 4 309 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B9I2 9.93e-29 117 27 4 309 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B1L1K9 1.02e-28 117 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Loch Maree / Type A3)
C3KXR0 1.14e-28 117 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain 657 / Type Ba4)
B1HS35 1.39e-28 117 26 7 380 3 recF DNA replication and repair protein RecF Lysinibacillus sphaericus (strain C3-41)
A6L3K9 2e-28 117 23 7 375 3 recF DNA replication and repair protein RecF Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
C0ZH40 2.18e-28 117 25 8 377 3 recF DNA replication and repair protein RecF Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q3KMU7 2.19e-28 116 27 4 310 3 recF DNA replication and repair protein RecF Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q97N32 2.67e-28 116 23 4 343 3 recF DNA replication and repair protein RecF Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A7G9B3 3.03e-28 116 23 6 366 3 recF DNA replication and repair protein RecF Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A9WR32 3.79e-28 116 26 9 386 3 recF DNA replication and repair protein RecF Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
A9VM93 3.98e-28 116 23 5 373 3 recF DNA replication and repair protein RecF Bacillus mycoides (strain KBAB4)
B0TAL0 4.29e-28 115 25 5 349 3 recF DNA replication and repair protein RecF Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q1MN15 5.14e-28 115 27 8 367 3 recF DNA replication and repair protein RecF Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q11NR3 5.6e-28 115 25 6 368 3 recF DNA replication and repair protein RecF Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q1DFP6 5.97e-28 115 24 3 374 3 recF DNA replication and repair protein RecF Myxococcus xanthus (strain DK1622)
Q3B6Y7 8.63e-28 115 26 5 330 3 recF DNA replication and repair protein RecF Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q38ZS1 1e-27 115 26 8 378 3 recF DNA replication and repair protein RecF Latilactobacillus sakei subsp. sakei (strain 23K)
B3PXG8 1.35e-27 114 27 8 367 3 recF DNA replication and repair protein RecF Rhizobium etli (strain CIAT 652)
A5D6E6 2.08e-27 114 27 14 379 3 recF DNA replication and repair protein RecF Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B3EJI1 2.15e-27 114 25 6 331 3 recF DNA replication and repair protein RecF Chlorobium phaeobacteroides (strain BS1)
Q5M237 2.73e-27 113 24 8 371 3 recF DNA replication and repair protein RecF Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
B0RH73 2.83e-27 114 25 8 383 3 recF DNA replication and repair protein RecF Clavibacter sepedonicus
Q1WVP2 3.06e-27 114 25 9 376 3 recF DNA replication and repair protein RecF Ligilactobacillus salivarius (strain UCC118)
Q252K0 3.1e-27 113 25 7 369 3 recF DNA replication and repair protein RecF Desulfitobacterium hafniense (strain Y51)
B8FXW8 3.1e-27 113 25 7 369 3 recF DNA replication and repair protein RecF Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q8DRR3 3.53e-27 113 25 7 366 3 recF DNA replication and repair protein RecF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P49997 3.62e-27 113 38 4 162 3 recF DNA replication and repair protein RecF Azotobacter vinelandii
P49997 0.000183 46 35 2 77 3 recF DNA replication and repair protein RecF Azotobacter vinelandii
Q9RVE0 5.49e-27 112 27 10 365 1 recF DNA replication and repair protein RecF Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A0LQR9 5.66e-27 112 27 7 354 3 recF DNA replication and repair protein RecF Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q67TK4 6.3e-27 112 28 10 375 3 recF DNA replication and repair protein RecF Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A4T4U1 7.59e-27 112 26 8 366 3 recF DNA replication and repair protein RecF Mycolicibacterium gilvum (strain PYR-GCK)
Q03I76 8.5e-27 112 24 8 371 3 recF DNA replication and repair protein RecF Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LXI7 8.5e-27 112 24 8 371 3 recF DNA replication and repair protein RecF Streptococcus thermophilus (strain CNRZ 1066)
A8YW44 8.6e-27 112 25 9 381 3 recF DNA replication and repair protein RecF Lactobacillus helveticus (strain DPC 4571)
B5ZWP8 1.13e-26 112 27 8 367 3 recF DNA replication and repair protein RecF Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B4S937 1.29e-26 112 26 7 338 3 recF DNA replication and repair protein RecF Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A3PSE0 2.08e-26 111 26 9 373 3 recF DNA replication and repair protein RecF Mycobacterium sp. (strain JLS)
C1CUE4 2.63e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain Taiwan19F-14)
C1CNK0 2.63e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain P1031)
Q8DMX3 2.63e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV1 2.63e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q1BG58 2.64e-26 111 26 9 373 3 recF DNA replication and repair protein RecF Mycobacterium sp. (strain MCS)
A1U8S3 2.64e-26 111 26 9 373 3 recF DNA replication and repair protein RecF Mycobacterium sp. (strain KMS)
A5CLT6 2.84e-26 111 26 8 375 3 recF DNA replication and repair protein RecF Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q97N44 3.12e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1IAD9 3.12e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain Hungary19A-6)
C1B7T0 3.24e-26 111 26 7 385 3 recF DNA replication and repair protein RecF Rhodococcus opacus (strain B4)
P36176 3.43e-26 110 26 8 361 3 recF DNA replication and repair protein RecF Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C1CHM6 4e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain JJA)
B8ZQB8 4e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CBK4 4e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain 70585)
B9JGW1 4.52e-26 110 27 8 369 3 recF DNA replication and repair protein RecF Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B2INP4 4.65e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae (strain CGSP14)
B5E455 4.65e-26 110 24 8 370 3 recF DNA replication and repair protein RecF Streptococcus pneumoniae serotype 19F (strain G54)
Q5FN12 4.9e-26 110 25 10 382 3 recF DNA replication and repair protein RecF Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A3DHZ7 5.61e-26 110 22 7 354 3 recF DNA replication and repair protein RecF Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B1VPF3 6.07e-26 110 27 8 363 3 recF DNA replication and repair protein RecF Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q1IXW9 6.92e-26 109 28 9 335 3 recF DNA replication and repair protein RecF Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q64XR8 7.53e-26 109 24 8 375 3 recF DNA replication and repair protein RecF Bacteroides fragilis (strain YCH46)
Q89ZW6 9.25e-26 109 23 8 375 3 recF DNA replication and repair protein RecF Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q5LGW6 9.29e-26 109 24 8 375 3 recF DNA replication and repair protein RecF Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B1I1H6 1.09e-25 109 28 10 371 3 recF DNA replication and repair protein RecF Desulforudis audaxviator (strain MP104C)
Q83N51 1.17e-25 109 25 8 367 3 recF DNA replication and repair protein RecF Tropheryma whipplei (strain Twist)
Q83NZ4 1.17e-25 109 25 8 367 3 recF DNA replication and repair protein RecF Tropheryma whipplei (strain TW08/27)
B2G4Y8 1.8e-25 108 25 7 374 3 recF DNA replication and repair protein RecF Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VHF6 1.8e-25 108 25 7 374 3 recF DNA replication and repair protein RecF Limosilactobacillus reuteri (strain DSM 20016)
C4Z176 2.47e-25 108 23 6 351 3 recF DNA replication and repair protein RecF Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
B3QWU7 3.05e-25 108 25 6 350 3 recF DNA replication and repair protein RecF Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
C1AJ00 4.31e-25 107 26 10 370 3 recF DNA replication and repair protein RecF Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Q7U314 4.31e-25 107 26 10 370 3 recF DNA replication and repair protein RecF Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A2RNA8 4.38e-25 107 27 9 325 3 recF DNA replication and repair protein RecF Lactococcus lactis subsp. cremoris (strain MG1363)
C3PE74 4.84e-25 107 27 8 364 3 recF DNA replication and repair protein RecF Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q8FUL4 5.36e-25 107 26 8 379 3 recF DNA replication and repair protein RecF Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A6L8H5 8.49e-25 106 25 6 366 3 recF DNA replication and repair protein RecF Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B3EDN1 8.77e-25 106 24 6 349 3 recF DNA replication and repair protein RecF Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q1GC40 8.95e-25 107 25 8 377 3 recF DNA replication and repair protein RecF Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
P9WHI9 9.23e-25 107 26 10 370 1 recF DNA replication and repair protein RecF Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY71 9.23e-25 107 26 10 370 3 recF DNA replication and repair protein RecF Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q98BH1 1.11e-24 106 27 9 347 3 recF DNA replication and repair protein RecF Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q4JYF5 1.15e-24 107 23 8 412 3 recF DNA replication and repair protein RecF Corynebacterium jeikeium (strain K411)
P9WHI8 1.16e-24 106 26 10 370 3 recF DNA replication and repair protein RecF Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6AHN3 1.16e-24 106 25 12 391 3 recF DNA replication and repair protein RecF Leifsonia xyli subsp. xyli (strain CTCB07)
Q04HR3 1.17e-24 106 25 7 376 3 recF DNA replication and repair protein RecF Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q03I57 1.17e-24 106 23 5 372 3 recF DNA replication and repair protein RecF Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q74M31 1.56e-24 106 24 8 378 3 recF DNA replication and repair protein RecF Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q47U20 1.59e-24 106 26 9 365 3 recF DNA replication and repair protein RecF Thermobifida fusca (strain YX)
Q839Z2 2.37e-24 105 24 7 379 3 recF DNA replication and repair protein RecF Enterococcus faecalis (strain ATCC 700802 / V583)
Q04CX2 2.66e-24 105 25 8 377 3 recF DNA replication and repair protein RecF Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q82FD5 2.71e-24 105 26 8 361 3 recF DNA replication and repair protein RecF Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A4X0U0 4.07e-24 105 25 9 386 3 recF DNA replication and repair protein RecF Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q0SAG4 4.89e-24 105 27 8 385 3 recF DNA replication and repair protein RecF Rhodococcus jostii (strain RHA1)
Q2KDX0 5.22e-24 104 26 8 367 3 recF DNA replication and repair protein RecF Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B2GEV1 5.58e-24 104 26 8 379 3 recF DNA replication and repair protein RecF Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
C1CW06 8.27e-24 103 28 9 340 3 recF DNA replication and repair protein RecF Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B9LH68 8.97e-24 104 26 10 398 3 recF DNA replication and repair protein RecF Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WDD4 8.97e-24 104 26 10 398 3 recF DNA replication and repair protein RecF Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q02WH8 9.1e-24 103 27 9 325 3 recF DNA replication and repair protein RecF Lactococcus lactis subsp. cremoris (strain SK11)
B9JZ91 2.63e-23 102 26 7 372 3 recF DNA replication and repair protein RecF Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A1T105 2.65e-23 102 26 8 364 3 recF DNA replication and repair protein RecF Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P46391 3.12e-23 102 26 10 361 3 recF DNA replication and repair protein RecF Mycobacterium leprae (strain TN)
B8ZTP0 3.12e-23 102 26 10 361 3 recF DNA replication and repair protein RecF Mycobacterium leprae (strain Br4923)
P0C561 3.44e-23 102 25 8 366 3 recF DNA replication and repair protein RecF Mycolicibacterium smegmatis
A0QND8 3.44e-23 102 25 8 366 3 recF DNA replication and repair protein RecF Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q6NKL5 3.6e-23 102 24 8 374 3 recF DNA replication and repair protein RecF Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q0RUP6 4.89e-23 102 27 9 387 3 recF DNA replication and repair protein RecF Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A0ZZA1 7.03e-23 102 23 4 339 3 recF DNA replication and repair protein RecF Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q9CE70 8.08e-23 101 26 8 323 3 recF DNA replication and repair protein RecF Lactococcus lactis subsp. lactis (strain IL1403)
Q8RDL3 8.14e-23 101 23 8 356 1 recF DNA replication and repair protein RecF Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B6YRR8 8.26e-23 101 25 9 380 3 recF DNA replication and repair protein RecF Azobacteroides pseudotrichonymphae genomovar. CFP2
Q8KA81 8.3e-23 101 24 8 352 3 recF DNA replication and repair protein RecF Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q6M8X7 9.74e-23 101 26 12 397 3 recF DNA replication and repair protein RecF Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B3QQY5 1.12e-22 100 24 9 355 3 recF DNA replication and repair protein RecF Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q047F1 1.12e-22 100 24 10 380 3 recF DNA replication and repair protein RecF Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B2HI48 1.86e-22 100 25 9 368 3 recF DNA replication and repair protein RecF Mycobacterium marinum (strain ATCC BAA-535 / M)
A8GQG2 2.24e-22 100 25 10 361 3 recF DNA replication and repair protein RecF Rickettsia rickettsii (strain Sheila Smith)
B0BVU8 2.24e-22 100 25 10 361 3 recF DNA replication and repair protein RecF Rickettsia rickettsii (strain Iowa)
A8EX95 4.13e-22 99 24 9 358 3 recF DNA replication and repair protein RecF Rickettsia canadensis (strain McKiel)
A4F5N5 4.33e-22 99 25 9 381 3 recF DNA replication and repair protein RecF Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
C4K0P8 4.74e-22 99 25 10 359 3 recF DNA replication and repair protein RecF Rickettsia peacockii (strain Rustic)
B7GSG2 5.3e-22 99 23 5 356 3 recF DNA replication and repair protein RecF Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8UJ65 5.66e-22 99 26 10 375 3 recF DNA replication and repair protein RecF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0B0Z2 6.49e-22 98 24 8 372 3 recF DNA replication and repair protein RecF Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q5Z3Z6 7.45e-22 99 25 9 369 3 recF DNA replication and repair protein RecF Nocardia farcinica (strain IFM 10152)
P56903 7.56e-22 98 25 8 373 3 recF DNA replication and repair protein RecF Rhizobium meliloti (strain 1021)
A5VA37 7.89e-22 98 27 9 344 3 recF DNA replication and repair protein RecF Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A8LVH1 8.12e-22 98 24 8 382 3 recF DNA replication and repair protein RecF Salinispora arenicola (strain CNS-205)
A4Q9S2 8.65e-22 99 26 12 397 3 recF DNA replication and repair protein RecF Corynebacterium glutamicum (strain R)
Q92JN5 1.82e-21 97 26 11 361 3 recF DNA replication and repair protein RecF Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A0PKB4 2.61e-21 97 25 9 370 3 recF DNA replication and repair protein RecF Mycobacterium ulcerans (strain Agy99)
C3PM56 2.99e-21 96 25 10 359 3 recF DNA replication and repair protein RecF Rickettsia africae (strain ESF-5)
A6W3V7 3.89e-21 97 26 9 376 3 recF DNA replication and repair protein RecF Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B8G3J6 6.96e-21 96 25 6 390 3 recF DNA replication and repair protein RecF Chloroflexus aggregans (strain MD-66 / DSM 9485)
C0ZLE4 7.79e-21 96 27 9 379 3 recF DNA replication and repair protein RecF Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q4UNG8 1.03e-20 95 24 10 361 3 recF DNA replication and repair protein RecF Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8G3E5 1.09e-20 95 28 11 372 3 recF DNA replication and repair protein RecF Brucella suis biovar 1 (strain 1330)
A0JQT5 1.3e-20 95 25 11 390 3 recF DNA replication and repair protein RecF Arthrobacter sp. (strain FB24)
B8H7D1 1.48e-20 95 24 9 395 3 recF DNA replication and repair protein RecF Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A8GLV2 1.62e-20 94 25 9 355 3 recF DNA replication and repair protein RecF Rickettsia akari (strain Hartford)
Q1RKJ9 1.67e-20 94 25 9 348 3 recF DNA replication and repair protein RecF Rickettsia bellii (strain RML369-C)
A8GUF0 3.17e-20 94 25 9 348 3 recF DNA replication and repair protein RecF Rickettsia bellii (strain OSU 85-389)
Q6ABL2 3.65e-20 94 25 11 376 3 recF DNA replication and repair protein RecF Cutibacterium acnes (strain DSM 16379 / KPA171202)
O83049 4.8e-20 93 22 9 360 3 recF DNA replication and repair protein RecF Treponema pallidum (strain Nichols)
Q8YED7 7.08e-20 93 28 11 372 3 recF DNA replication and repair protein RecF Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57G08 7.08e-20 93 28 11 372 3 recF DNA replication and repair protein RecF Brucella abortus biovar 1 (strain 9-941)
Q2YPM3 7.08e-20 93 28 11 372 3 recF DNA replication and repair protein RecF Brucella abortus (strain 2308)
C5C7X6 1.04e-19 92 26 7 369 3 recF DNA replication and repair protein RecF Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
C5BUP6 1.11e-19 92 25 7 386 3 recF DNA replication and repair protein RecF Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
B1ZSD3 1.25e-19 92 28 10 345 3 recF DNA replication and repair protein RecF Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A8F0D4 1.87e-19 91 24 10 359 3 recF DNA replication and repair protein RecF Rickettsia massiliae (strain Mtu5)
B9KZ04 5.34e-19 90 24 12 395 3 recF DNA replication and repair protein RecF Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
A7NF69 1.17e-18 89 27 10 378 3 recF DNA replication and repair protein RecF Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A1R0S5 1.19e-18 89 25 9 382 3 recF DNA replication and repair protein RecF Paenarthrobacter aurescens (strain TC1)
Q68XQ6 1.64e-18 89 24 11 362 3 recF DNA replication and repair protein RecF Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A0Q8R8 2.73e-18 88 26 11 382 3 recF DNA replication and repair protein RecF Mycobacterium avium (strain 104)
Q9L7L5 7.27e-18 87 26 11 382 3 recF DNA replication and repair protein RecF Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9ZEB6 9.98e-17 84 24 10 361 3 recF DNA replication and repair protein RecF Rickettsia prowazekii (strain Madrid E)
A9B775 1.63e-15 80 27 11 381 3 recF DNA replication and repair protein RecF Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q7U4L8 6.29e-15 78 27 10 348 3 recF DNA replication and repair protein RecF Parasynechococcus marenigrum (strain WH8102)
A1SCL9 1.59e-14 77 23 9 406 3 recF DNA replication and repair protein RecF Nocardioides sp. (strain ATCC BAA-499 / JS614)
B8GXP9 3.08e-14 76 25 10 355 3 recF DNA replication and repair protein RecF Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW1 3.08e-14 76 25 10 355 3 recF DNA replication and repair protein RecF Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8YRR9 1.29e-13 74 24 7 376 3 recF DNA replication and repair protein RecF Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3M7N8 1.99e-13 74 24 9 382 3 recF DNA replication and repair protein RecF Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2IVZ4 2.33e-13 73 24 9 377 3 recF DNA replication and repair protein RecF Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B0T360 2.79e-13 73 25 10 360 3 recF DNA replication and repair protein RecF Caulobacter sp. (strain K31)
B0CB57 9.13e-13 72 23 7 376 3 recF DNA replication and repair protein RecF Acaryochloris marina (strain MBIC 11017)
Q7NHY0 3.01e-12 70 25 8 386 3 recF DNA replication and repair protein RecF Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q114T6 5.56e-12 70 22 6 319 3 recF DNA replication and repair protein RecF Trichodesmium erythraeum (strain IMS101)
Q3AML2 5.41e-11 66 27 10 352 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain CC9605)
B1WT39 2.52e-10 64 21 7 388 3 recF DNA replication and repair protein RecF Crocosphaera subtropica (strain ATCC 51142 / BH68)
B7KID4 2.91e-10 64 23 9 341 3 recF DNA replication and repair protein RecF Gloeothece citriformis (strain PCC 7424)
B0JM53 7.23e-10 63 23 8 385 3 recF DNA replication and repair protein RecF Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
P73532 1.63e-09 62 24 9 337 3 recF DNA replication and repair protein RecF Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DG79 1.9e-09 62 25 8 337 3 recF DNA replication and repair protein RecF Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B7K127 2.66e-09 61 24 9 386 3 recF DNA replication and repair protein RecF Rippkaea orientalis (strain PCC 8801 / RF-1)
Q2JIB8 3.05e-09 61 24 5 345 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2JQG8 3.1e-09 61 23 7 334 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain JA-3-3Ab)
B1XJ90 1.46e-08 59 22 8 384 3 recF DNA replication and repair protein RecF Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q5N0Y2 1.41e-06 53 23 6 375 3 recF DNA replication and repair protein RecF Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31KY9 2.14e-06 52 23 6 375 3 recF DNA replication and repair protein RecF Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B8HVF7 2.33e-05 49 23 8 338 3 recF DNA replication and repair protein RecF Cyanothece sp. (strain PCC 7425 / ATCC 29141)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17585
Feature type CDS
Gene recF
Product DNA replication/repair protein RecF
Location 152083 - 153165 (strand: 1)
Length 1083 (nucleotides) / 360 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2120
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02463 RecF/RecN/SMC N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1195 Replication, recombination and repair (L) L Recombinational DNA repair ATPase RecF

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03629 DNA replication and repair protein RecF Homologous recombination -

Protein Sequence

MILSRLLIRDFRNIEDADLSPANGFNFLIGPNGSGKTSVLEAIYTLGHGRAFRSVQAGRVIRHESEEFILHGKLGQENTDRATSVGLSKNRQGDSKVRIDGTDGHKIAELAKLLPMQLITPEGFTLLNGGPKFRRAFIDWGCFHNEPQFFAVWSDLKRLVKQRNAALRQVSNYSQIRHWDQQLIPVATQVSQWRENYVTAIAQDIEQTCQQFLPEFSLSVSFQRGWEKETDYSELLQRQFERDRSLTYTASGPHKADLRIRADGVPVEDLLSRGQLKLLMCALRLAQGEYFTRQSGQQCLYLLDDFASELDAGRRRLLAHRLKATQAQVFVSAITPEQVTDMADENSRLFFVEKGKIQVQ

Flanking regions ( +/- flanking 50bp)

CCGCCAGTGATGCAGCCGCGTATGTTGTAATGCCGATGCGCCTGTAATATATGATCCTTTCGCGTTTACTTATCCGCGATTTTCGTAATATCGAAGACGCGGATTTGTCGCCTGCCAACGGGTTTAATTTTTTAATCGGTCCGAACGGCAGCGGCAAAACCAGTGTTCTGGAAGCAATTTATACACTCGGTCATGGCAGAGCGTTCCGGTCAGTTCAGGCTGGTCGGGTTATCCGTCATGAAAGTGAAGAATTTATTCTTCACGGCAAATTAGGTCAGGAAAATACCGACAGAGCCACCAGCGTTGGCCTGAGTAAAAACCGGCAGGGTGACAGCAAAGTCCGTATTGATGGTACTGACGGACACAAAATTGCTGAGCTGGCAAAATTATTGCCAATGCAATTAATCACCCCTGAAGGCTTTACCCTGCTCAATGGCGGACCAAAATTCCGCCGTGCTTTTATTGACTGGGGCTGTTTCCACAACGAACCACAATTTTTTGCCGTGTGGAGTGATTTAAAACGCCTGGTGAAACAGCGCAATGCCGCACTTCGTCAGGTGTCGAATTACAGTCAGATCCGTCACTGGGATCAGCAACTGATTCCGGTTGCGACGCAAGTCAGCCAGTGGCGGGAAAATTATGTGACAGCGATTGCTCAGGATATTGAGCAGACCTGTCAGCAGTTTTTACCTGAATTTTCACTGAGCGTCTCTTTCCAGCGCGGATGGGAGAAAGAGACCGATTATTCAGAGCTGCTTCAGCGCCAGTTTGAACGTGACCGCTCACTTACGTATACCGCCTCCGGCCCGCACAAAGCGGATTTACGGATAAGGGCAGACGGAGTGCCGGTGGAAGACTTACTTTCACGCGGTCAGTTAAAACTACTTATGTGCGCGCTGCGGTTAGCACAGGGTGAATATTTCACCCGTCAGAGCGGGCAGCAATGCCTGTATCTGCTTGATGATTTTGCCTCCGAGCTCGATGCCGGGCGTCGCCGTTTACTGGCACACCGGCTGAAAGCCACGCAAGCACAGGTTTTCGTCAGCGCAATCACACCTGAACAGGTGACCGATATGGCTGATGAAAATAGTCGTCTGTTCTTCGTGGAAAAAGGTAAAATACAGGTTCAATAATCAGGATTAGATAAGCGGGAAACGTTGATGTCGAATACTTATGACTCCTC