Homologs in group_2033

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11015 EHELCC_11015 100.0 Morganella morganii S2 pncC nicotinamide-nucleotide amidase
NLDBIP_11360 NLDBIP_11360 100.0 Morganella morganii S4 pncC nicotinamide-nucleotide amidase
LHKJJB_11220 LHKJJB_11220 100.0 Morganella morganii S3 pncC nicotinamide-nucleotide amidase
HKOGLL_09830 HKOGLL_09830 100.0 Morganella morganii S5 pncC nicotinamide-nucleotide amidase
F4V73_RS12215 F4V73_RS12215 83.8 Morganella psychrotolerans pncC nicotinamide-nucleotide amidase
PMI_RS01790 PMI_RS01790 59.5 Proteus mirabilis HI4320 pncC nicotinamide-nucleotide amidase

Distribution of the homologs in the orthogroup group_2033

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2033

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A6G3 2.72e-59 185 62 2 161 1 pncC Nicotinamide-nucleotide amidohydrolase PncC Escherichia coli (strain K12)
P0A6G4 2.72e-59 185 62 2 161 3 pncC Nicotinamide-nucleotide amidohydrolase PncC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83JZ0 3.12e-58 182 63 2 157 3 pncC Nicotinamide-nucleotide amidohydrolase PncC Shigella flexneri
P51967 1.37e-54 173 62 2 156 3 pncC Nicotinamide-nucleotide amidohydrolase PncC Enterobacter agglomerans
Q67NW5 5.35e-43 150 53 3 161 3 cinA Putative competence-damage inducible protein Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P72227 1.41e-41 139 49 1 161 3 pncC Nicotinamide-nucleotide amidohydrolase PncC Pseudomonas putida
B2UNF6 3.49e-40 143 51 1 146 3 Amuc_0430 CinA-like protein Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A6M320 1.12e-39 141 48 1 150 3 cinA Putative competence-damage inducible protein Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q74GV1 2.33e-39 140 51 1 148 3 GSU0143 CinA-like protein Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B3QTC8 9.39e-39 139 52 0 134 3 Ctha_1770 CinA-like protein Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B1GZ34 1.08e-38 139 49 1 147 3 TGRD_033 CinA-like protein Endomicrobium trichonymphae
B3EHJ0 1.2e-37 136 53 1 129 3 Clim_2329 CinA-like protein Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
C6E6X4 9.15e-37 134 49 2 157 3 GM21_3733 CinA-like protein Geobacter sp. (strain M21)
A4XLD7 1.03e-36 134 45 2 159 3 cinA Putative competence-damage inducible protein Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q8RA54 4.26e-36 132 44 1 154 3 cinA Putative competence-damage inducible protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B3EL42 9.73e-36 131 48 2 140 3 Cphamn1_0300 CinA-like protein Chlorobium phaeobacteroides (strain BS1)
B0K9N3 2.38e-35 130 45 1 137 3 cinA Putative competence-damage inducible protein Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C5CFW1 2.77e-35 130 45 1 144 3 Kole_1770 CinA-like protein Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q898T5 3e-35 130 42 1 148 3 cinA Putative competence-damage inducible protein Clostridium tetani (strain Massachusetts / E88)
B5ED03 4.87e-35 129 48 2 157 3 Gbem_3628 CinA-like protein Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B9M363 7.6e-35 129 53 1 129 3 Geob_1113 CinA-like protein Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q8KAX2 7.95e-35 129 48 3 147 3 CT2029 CinA-like protein Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3QL60 1.55e-34 128 50 3 145 3 Cpar_1906 CinA-like protein Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B0K1B9 1.77e-34 128 45 1 137 3 cinA Putative competence-damage inducible protein Thermoanaerobacter sp. (strain X514)
A3DEA5 2.39e-34 127 43 1 142 3 cinA Putative competence-damage inducible protein Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q04TG1 7.56e-34 126 45 1 146 3 LBJ_1205 CinA-like protein Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q052J0 8.54e-34 126 45 1 146 3 LBL_1257 CinA-like protein Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
B8CXC3 9.57e-34 126 45 3 151 3 cinA Putative competence-damage inducible protein Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q12SN4 1.18e-33 126 51 0 121 3 Sden_0246 CinA-like protein Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q47XX0 1.45e-33 125 53 0 113 3 CPS_3682 CinA-like protein Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B1KNC9 1.61e-33 125 53 0 122 3 Swoo_0325 CinA-like protein Shewanella woodyi (strain ATCC 51908 / MS32)
A5GDB4 1.76e-33 125 46 2 148 3 Gura_0217 CinA-like protein Geotalea uraniireducens (strain Rf4)
B9MQY2 2.42e-33 125 44 2 154 3 cinA Putative competence-damage inducible protein Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q0SWN5 4.69e-33 124 43 2 146 3 cinA Putative competence-damage inducible protein Clostridium perfringens (strain SM101 / Type A)
A3DA29 6.28e-33 124 53 0 116 3 Sbal_4127 CinA-like protein Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KTZ3 6.48e-33 124 53 0 116 3 Sbal195_4216 CinA-like protein Shewanella baltica (strain OS195)
A6WTS6 7.04e-33 124 53 0 116 3 Shew185_4098 CinA-like protein Shewanella baltica (strain OS185)
B8EBG6 9.12e-33 123 53 0 116 3 Sbal223_4017 CinA-like protein Shewanella baltica (strain OS223)
Q1AT03 2.04e-32 122 45 2 155 3 Rxyl_2558 CinA-like protein Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B0SSV0 2.85e-32 122 44 2 136 3 LEPBI_I2088 CinA-like protein Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SB28 2.85e-32 122 44 2 136 3 LBF_2034 CinA-like protein Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A5N2R5 2.9e-32 122 41 1 146 3 cinA Putative competence-damage inducible protein Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E6E0 2.9e-32 122 41 1 146 3 cinA Putative competence-damage inducible protein Clostridium kluyveri (strain NBRC 12016)
Q3AUA4 3.72e-32 122 50 0 115 3 Cag_0143 CinA-like protein Chlorobium chlorochromatii (strain CaD3)
Q0TUU6 5.91e-32 121 43 2 146 3 cinA Putative competence-damage inducible protein Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q5LCF4 6.25e-32 121 51 0 115 3 BF2511 CinA-like protein Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8XP33 6.36e-32 121 43 2 146 3 cinA Putative competence-damage inducible protein Clostridium perfringens (strain 13 / Type A)
A0L257 6.61e-32 121 51 0 116 3 Shewana3_3908 CinA-like protein Shewanella sp. (strain ANA-3)
Q72QL2 7.65e-32 121 43 1 146 3 LIC_12101 CinA-like protein Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q0I067 7.8e-32 121 51 0 116 3 Shewmr7_0233 CinA-like protein Shewanella sp. (strain MR-7)
Q0HDU2 7.96e-32 121 51 0 116 3 Shewmr4_3712 CinA-like protein Shewanella sp. (strain MR-4)
Q8F5J2 8.14e-32 121 43 1 146 3 LA_1689 CinA-like protein Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q64TK0 9.56e-32 120 50 0 115 3 BF2430 CinA-like protein Bacteroides fragilis (strain YCH46)
A1RPS2 1.71e-31 120 51 0 116 3 Sputw3181_3863 CinA-like protein Shewanella sp. (strain W3-18-1)
A4YBU5 1.71e-31 120 51 0 116 3 Sputcn32_3720 CinA-like protein Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A4TAK5 1.88e-31 120 51 1 132 3 Mflv_3280 CinA-like protein Mycolicibacterium gilvum (strain PYR-GCK)
Q97D94 1.92e-31 120 44 2 141 3 cinA Putative competence-damage inducible protein Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8RHR9 2.22e-31 119 42 3 149 3 FN1929 CinA-like protein Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9S5X1 2.62e-31 119 42 1 138 3 TM_0703 CinA-like protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1BJF2 2.71e-31 119 45 3 146 3 Cpha266_2541 CinA-like protein Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q39Z82 2.72e-31 119 45 2 148 3 Gmet_0196 CinA-like protein Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B1L804 2.85e-31 119 42 1 138 3 TRQ2_0225 CinA-like protein Thermotoga sp. (strain RQ2)
A8G1B1 3.01e-31 119 44 3 159 3 Ssed_4280 CinA-like protein Shewanella sediminis (strain HAW-EB3)
A9BHX8 3.28e-31 119 39 1 153 3 Pmob_1389 CinA-like protein Petrotoga mobilis (strain DSM 10674 / SJ95)
B9KAS5 5.48e-31 118 39 1 144 3 CTN_1882 CinA-like protein Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A0PXD7 7.76e-31 118 40 2 157 3 cinA Putative competence-damage inducible protein Clostridium novyi (strain NT)
A8GZ14 8.03e-31 118 50 0 116 3 Spea_0223 CinA-like protein Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8EK32 1.13e-30 118 50 0 116 1 pncC Nicotinamide-nucleotide amidohydrolase PncC Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A5IJ83 1.24e-30 117 41 1 138 3 Tpet_0227 CinA-like protein Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A7HNE6 3.08e-30 116 44 2 144 3 Fnod_1586 CinA-like protein Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q0AXI8 3.45e-30 116 43 1 144 3 Swol_1257 CinA-like protein Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A8MI49 4.39e-30 116 39 2 153 3 cinA Putative competence-damage inducible protein Alkaliphilus oremlandii (strain OhILAs)
A1S257 6.84e-30 115 50 0 116 3 Sama_0252 CinA-like protein Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q089L6 9.51e-30 115 49 0 117 3 Sfri_0186 CinA-like protein Shewanella frigidimarina (strain NCIMB 400)
Q88UZ3 9.85e-30 115 40 2 144 3 cinA Putative competence-damage inducible protein Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P31131 1.27e-29 109 42 0 123 3 ydeJ Protein YdeJ Escherichia coli (strain K12)
Q3A1W5 2.33e-29 114 45 2 133 3 Pcar_2403 CinA-like protein Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B1I313 5.05e-29 113 40 1 156 3 cinA Putative competence-damage inducible protein Desulforudis audaxviator (strain MP104C)
A0LLA6 7.19e-29 113 45 1 137 3 Sfum_2530 CinA-like protein Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A5D2R7 9.87e-29 112 43 1 137 3 cinA Putative competence-damage inducible protein Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q2LPL3 1.34e-28 112 43 3 154 3 SYNAS_03440 CinA-like protein Syntrophus aciditrophicus (strain SB)
A8ZZX4 1.72e-28 112 47 1 130 3 Dole_1570 CinA-like protein Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B8I7D0 1.78e-28 112 40 2 154 3 cinA Putative competence-damage inducible protein Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B7KFE8 2.35e-28 111 46 0 113 3 PCC7424_3471 CinA-like protein Gloeothece citriformis (strain PCC 7424)
A1ALN8 2.4e-28 111 42 2 155 3 Ppro_0627 CinA-like protein Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q18BS8 2.4e-28 111 40 1 150 3 cinA Putative competence-damage inducible protein Clostridioides difficile (strain 630)
Q73ZH8 2.44e-28 112 43 2 158 3 cinA CinA-like protein Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9X7D6 2.84e-28 111 45 2 141 3 cinA CinA-like protein Mycobacterium leprae (strain TN)
A6TNW2 3.11e-28 111 40 1 150 3 cinA Putative competence-damage inducible protein Alkaliphilus metalliredigens (strain QYMF)
A1T9F4 3.48e-28 111 49 1 132 3 Mvan_2999 CinA-like protein Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A3Q9C2 3.59e-28 111 46 2 147 3 Shew_0198 CinA-like protein Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TL92 3.67e-28 111 42 2 152 3 Shal_4097 CinA-like protein Shewanella halifaxensis (strain HAW-EB4)
P9WPE3 8.15e-28 110 46 2 138 1 cinA CinA-like protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPE2 8.15e-28 110 46 2 138 3 cinA CinA-like protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U3S0 8.15e-28 110 46 2 138 3 MRA_1912 CinA-like protein Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1API1 8.15e-28 110 46 2 138 3 JTY_1924 CinA-like protein Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJW6 8.15e-28 110 46 2 138 3 BCG_1940 CinA-like protein Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63776 8.15e-28 110 46 2 138 3 cinA CinA-like protein Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A8F4W4 9.27e-28 110 42 2 135 3 Tlet_0632 CinA-like protein Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B8CNH3 1e-27 110 48 0 116 3 swp_2051 CinA-like protein Shewanella piezotolerans (strain WP3 / JCM 13877)
B3ER86 1.09e-27 110 45 0 103 3 Aasi_0301 CinA-like protein Amoebophilus asiaticus (strain 5a2)
Q82Z98 1.69e-27 109 40 5 168 3 cinA Putative competence-damage inducible protein Enterococcus faecalis (strain ATCC 700802 / V583)
Q11S34 2e-27 109 46 0 117 3 CHU_2526 CinA-like protein Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B2HDA1 2.19e-27 109 45 1 132 3 MMAR_2796 CinA-like protein Mycobacterium marinum (strain ATCC BAA-535 / M)
A0QGE9 3.72e-27 108 42 2 158 3 MAV_2800 CinA-like protein Mycobacterium avium (strain 104)
A6LL44 4.53e-27 108 41 1 145 3 Tmel_0783 CinA-like protein Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
A4SGM6 5.27e-27 108 46 3 140 3 Cvib_1625 CinA-like protein Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q3B1F7 9.31e-27 107 44 1 131 3 Plut_1982 CinA-like protein Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A0QY28 1.28e-26 107 46 2 132 3 cinA CinA-like protein Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1B8H0 1.87e-26 106 47 2 132 3 Mmcs_2707 CinA-like protein Mycobacterium sp. (strain MCS)
A1UGI7 1.87e-26 106 47 2 132 3 Mkms_2751 CinA-like protein Mycobacterium sp. (strain KMS)
Q03R28 2.23e-26 106 40 2 150 3 cinA Putative competence-damage inducible protein Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q111G9 2.33e-26 106 39 1 148 3 Tery_2662 CinA-like protein Trichodesmium erythraeum (strain IMS101)
A2BUN8 4.71e-26 105 38 3 163 3 P9515_02901 CinA-like protein Prochlorococcus marinus (strain MIT 9515)
B1IDA0 5.64e-26 105 35 1 148 3 cinA Putative competence-damage inducible protein Clostridium botulinum (strain Okra / Type B1)
Q2IFM3 5.99e-26 105 47 2 132 3 Adeh_3614 CinA-like protein Anaeromyxobacter dehalogenans (strain 2CP-C)
A7FQM1 8.22e-26 104 35 1 148 3 cinA Putative competence-damage inducible protein Clostridium botulinum (strain ATCC 19397 / Type A)
A3Q040 8.35e-26 105 46 2 132 3 Mjls_2737 CinA-like protein Mycobacterium sp. (strain JLS)
C1FQU7 8.65e-26 104 35 1 148 3 cinA Putative competence-damage inducible protein Clostridium botulinum (strain Kyoto / Type A2)
C0QI20 9.8e-26 104 48 0 114 3 HRM2_26620 CinA-like protein Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B8J0U1 1.1e-25 104 49 0 99 3 Ddes_1466 CinA-like protein Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A7G9W4 1.14e-25 104 35 1 148 3 cinA Putative competence-damage inducible protein Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q6AIZ4 1.17e-25 104 39 1 148 3 DP2957 CinA-like protein Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B2V6Y9 1.21e-25 104 39 1 138 3 SYO3AOP1_0125 CinA-like protein Sulfurihydrogenibium sp. (strain YO3AOP1)
B1KSY5 1.34e-25 104 35 1 148 3 cinA Putative competence-damage inducible protein Clostridium botulinum (strain Loch Maree / Type A3)
B7JYM6 2.01e-25 103 39 1 148 3 PCC8801_0814 CinA-like protein Rippkaea orientalis (strain PCC 8801 / RF-1)
A3PAX8 2.23e-25 103 40 1 142 3 P9301_02801 CinA-like protein Prochlorococcus marinus (strain MIT 9301)
Q3AN01 2.8e-25 103 42 2 145 3 Syncc9605_0255 CinA-like protein Synechococcus sp. (strain CC9605)
Q7TUG2 3.23e-25 103 41 2 139 3 PMM0257 CinA-like protein Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q9EXC9 3.29e-25 98 37 3 157 1 MPN_254 Protein MG115 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
C3KYP8 3.79e-25 103 34 1 148 3 cinA Putative competence-damage inducible protein Clostridium botulinum (strain 657 / Type Ba4)
B4UD97 3.95e-25 102 46 2 132 3 AnaeK_3683 CinA-like protein Anaeromyxobacter sp. (strain K)
B8J6V6 4.07e-25 102 46 2 132 3 A2cp1_3752 CinA-like protein Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
C1F6H5 1.02e-24 102 40 1 143 3 ACP_3409 CinA-like protein Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B8DYM0 2.94e-24 100 37 1 135 3 Dtur_0064 CinA-like protein Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B5YB52 3.87e-24 100 36 1 139 3 DICTH_1766 CinA-like protein Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B0JVG7 4.16e-24 100 40 1 138 3 MAE_16790 CinA-like protein Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B0CEJ2 7.99e-24 99 42 0 118 3 AM1_1941 CinA-like protein Acaryochloris marina (strain MBIC 11017)
Q03AQ1 8.85e-24 99 39 3 156 3 cinA Putative competence-damage inducible protein Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8YMW6 8.93e-24 99 42 0 113 3 alr4808 CinA-like protein Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B3WCM0 9.12e-24 99 39 3 156 3 cinA Putative competence-damage inducible protein Lacticaseibacillus casei (strain BL23)
Q31RK7 1.03e-23 99 40 1 148 3 Synpcc7942_0280 CinA-like protein Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q3MBD6 1.1e-23 99 42 0 113 3 Ava_2078 CinA-like protein Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5N2P7 1.2e-23 99 40 1 148 3 cinA CinA-like protein Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
A4J5U0 1.97e-23 98 39 3 141 3 cinA Putative competence-damage inducible protein Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q03EQ4 2.46e-23 98 36 2 143 3 cinA Putative competence-damage inducible protein Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q55760 3.24e-23 97 44 0 113 3 slr0427 CinA-like protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2S304 3.84e-23 97 45 0 113 3 SRU_1303 CinA-like protein Salinibacter ruber (strain DSM 13855 / M31)
B1WSM0 7.91e-23 96 45 0 113 3 cce_4251 CinA-like protein Crocosphaera subtropica (strain ATCC 51142 / BH68)
B8HR57 9.37e-23 96 42 1 124 3 Cyan7425_1676 CinA-like protein Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q3AW20 1.1e-22 96 46 0 113 3 Syncc9902_2089 CinA-like protein Synechococcus sp. (strain CC9902)
Q46HB7 1.21e-22 96 46 0 107 3 PMN2A_1623 CinA-like protein Prochlorococcus marinus (strain NATL2A)
A2C089 1.4e-22 96 46 0 107 3 NATL1_03351 CinA-like protein Prochlorococcus marinus (strain NATL1A)
B2J2A3 1.7e-22 95 42 0 113 3 Npun_F5157 CinA-like protein Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A8FDG2 2.93e-22 95 34 2 150 3 cinA Putative competence-damage inducible protein Bacillus pumilus (strain SAFR-032)
Q8DH31 2.99e-22 95 39 2 146 3 tlr2129 CinA-like protein Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q1IPQ9 3.46e-22 95 37 2 137 3 Acid345_2140 CinA-like protein Koribacter versatilis (strain Ellin345)
Q7NHU4 5.18e-22 94 41 1 124 3 glr2441 CinA-like protein Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A7GRB0 9.8e-22 93 33 3 160 3 cinA Putative competence-damage inducible protein Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A6GZI7 1.01e-21 93 40 0 113 3 FP1434 CinA-like protein Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A7HGS8 1.16e-21 93 42 2 135 3 Anae109_3745 CinA-like protein Anaeromyxobacter sp. (strain Fw109-5)
Q31CS5 1.46e-21 93 42 2 133 3 PMT9312_0259 CinA-like protein Prochlorococcus marinus (strain MIT 9312)
A9FML0 2.03e-21 92 41 3 143 3 sce8168 CinA-like protein Sorangium cellulosum (strain So ce56)
Q7U9J5 2.07e-21 92 45 0 108 3 SYNW0261 CinA-like protein Parasynechococcus marenigrum (strain WH8102)
C1A7F4 2.08e-21 92 39 2 149 3 GAU_1122 CinA-like protein Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A8G2R7 2.16e-21 92 44 2 133 3 P9215_02811 CinA-like protein Prochlorococcus marinus (strain MIT 9215)
Q028J4 2.63e-21 92 36 2 156 3 Acid_1567 CinA-like protein Solibacter usitatus (strain Ellin6076)
B1XKM7 2.66e-21 92 36 1 138 3 SYNPCC7002_A2525 CinA-like protein Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B2GB14 3.92e-21 92 36 3 149 3 cinA Putative competence-damage inducible protein Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q2J752 4.65e-21 92 40 2 142 3 Francci3_3538 CinA-like protein Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q92BV8 4.67e-21 92 35 3 155 3 cinA Putative competence-damage inducible protein Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P46323 1.45e-20 90 31 3 167 3 cinA Putative competence-damage inducible protein Bacillus subtilis (strain 168)
B9IV71 2.66e-20 89 34 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain Q1)
B7HLB5 2.88e-20 89 34 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain AH187)
Q71ZS3 3.06e-20 89 33 4 181 3 cinA Putative competence-damage inducible protein Listeria monocytogenes serotype 4b (strain F2365)
C1L2V3 3.06e-20 89 33 4 181 3 cinA Putative competence-damage inducible protein Listeria monocytogenes serotype 4b (strain CLIP80459)
Q636P5 3.24e-20 89 34 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain ZK / E33L)
Q732U5 3.44e-20 89 34 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain ATCC 10987 / NRS 248)
B7ITN2 4e-20 89 33 3 160 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain G9842)
B8DFT0 6.09e-20 88 35 3 154 3 cinA Putative competence-damage inducible protein Listeria monocytogenes serotype 4a (strain HCC23)
Q65JF3 6.93e-20 88 33 2 160 3 cinA Putative competence-damage inducible protein Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
C1EP04 7.13e-20 88 33 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain 03BB102)
A0RHF2 7.13e-20 88 33 3 149 3 cinA Putative competence-damage inducible protein Bacillus thuringiensis (strain Al Hakam)
Q0IDD6 7.56e-20 88 42 0 107 3 sync_0302 CinA-like protein Synechococcus sp. (strain CC9311)
B7HDQ5 8.19e-20 88 33 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain B4264)
Q8Y793 9.15e-20 88 33 4 181 3 cinA Putative competence-damage inducible protein Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A7Z4W4 1.11e-19 88 32 4 165 3 cinA Putative competence-damage inducible protein Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q81A15 1.18e-19 87 33 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HF34 1.33e-19 87 33 3 149 3 cinA Putative competence-damage inducible protein Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7JJ59 1.33e-19 87 33 3 149 3 cinA Putative competence-damage inducible protein Bacillus cereus (strain AH820)
Q1DCC8 2.66e-19 87 38 1 144 3 MXAN_1438 CinA-like protein Myxococcus xanthus (strain DK1622)
A5F9Y3 3e-19 87 34 3 163 3 Fjoh_4984 CinA-like protein Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q9KAA5 3.46e-19 86 35 4 162 3 cinA Putative competence-damage inducible protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8EQR8 4.28e-19 86 32 2 152 3 cinA Putative competence-damage inducible protein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C0MGB7 4.36e-19 86 37 2 128 3 cinA Putative competence-damage inducible protein Streptococcus equi subsp. zooepidemicus (strain H70)
Q2RKI6 4.52e-19 86 42 1 144 3 cinA Putative competence-damage inducible protein Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A9VS24 4.61e-19 86 31 3 164 3 cinA Putative competence-damage inducible protein Bacillus mycoides (strain KBAB4)
Q7VDS9 6.05e-19 85 34 2 149 3 cinA CinA-like protein Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A0AIJ9 1e-18 85 31 4 182 3 cinA Putative competence-damage inducible protein Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A2BP56 1.35e-18 85 41 2 139 3 A9601_02791 CinA-like protein Prochlorococcus marinus (strain AS9601)
Q81WQ3 1.66e-18 84 32 3 149 3 cinA Putative competence-damage inducible protein Bacillus anthracis
C3L7E6 1.66e-18 84 32 3 149 3 cinA Putative competence-damage inducible protein Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5I7 1.66e-18 84 32 3 149 3 cinA Putative competence-damage inducible protein Bacillus anthracis (strain A0248)
A5GWH4 1.66e-18 84 45 0 103 3 SynRCC307_2330 CinA-like protein Synechococcus sp. (strain RCC307)
A5GIG6 4.8e-18 83 42 0 106 3 SynWH7803_0305 CinA-like protein Synechococcus sp. (strain WH7803)
Q5L0F7 5.36e-18 83 35 2 148 3 cinA Putative competence-damage inducible protein Geobacillus kaustophilus (strain HTA426)
Q8DRX2 5.45e-18 83 35 2 142 1 cinA Putative competence-damage inducible protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P47361 6.09e-18 79 40 1 101 3 MG115 Protein MG115 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
B0S3U9 7.44e-18 82 33 4 156 3 cinA Putative competence-damage inducible protein Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
C5D9G1 7.78e-18 82 31 4 164 3 cinA Putative competence-damage inducible protein Geobacillus sp. (strain WCH70)
B4U0I9 1.28e-17 82 35 2 128 3 cinA Putative competence-damage inducible protein Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MAR7 1.77e-17 82 35 2 128 3 cinA Putative competence-damage inducible protein Streptococcus equi subsp. equi (strain 4047)
B5XJ05 2.84e-17 81 36 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M49 (strain NZ131)
A8AZT4 3.46e-17 80 38 3 141 3 cinA Putative competence-damage inducible protein Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B7GJN4 4.34e-17 80 34 3 154 3 cinA Putative competence-damage inducible protein Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q1J494 5.64e-17 80 37 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M4 (strain MGAS10750)
P0DA27 5.69e-17 80 37 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DA26 5.69e-17 80 37 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A0M3L5 7.92e-17 80 35 1 148 3 GFO_2245 CinA-like protein Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q99XP1 1.13e-16 79 36 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M1
Q48QW6 1.23e-16 79 36 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JEH6 1.23e-16 79 36 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M2 (strain MGAS10270)
B8ZNU8 1.76e-16 79 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C9K9 1.76e-16 79 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain 70585)
B2A3C4 1.88e-16 79 34 3 149 3 cinA Putative competence-damage inducible protein Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B2G6E2 3.2e-16 78 32 2 150 3 cinA Putative competence-damage inducible protein Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VIW6 3.2e-16 78 32 2 150 3 cinA Putative competence-damage inducible protein Limosilactobacillus reuteri (strain DSM 20016)
C1CMP6 3.6e-16 78 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain P1031)
C1CGM5 3.6e-16 78 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain JJA)
B2IM29 3.74e-16 78 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain CGSP14)
Q03MX6 4.94e-16 77 38 2 115 3 cinA Putative competence-damage inducible protein Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q7ZAK3 5.86e-16 77 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q7TUN0 5.98e-16 77 42 0 110 3 PMT_1845 CinA-like protein Prochlorococcus marinus (strain MIT 9313)
Q04IM5 6.16e-16 77 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C1CTH7 6.22e-16 77 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain Taiwan19F-14)
B1I8Q2 6.22e-16 77 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae (strain Hungary19A-6)
B5E2E1 6.22e-16 77 34 2 126 3 cinA Putative competence-damage inducible protein Streptococcus pneumoniae serotype 19F (strain G54)
P54184 8.25e-16 77 34 2 126 2 cinA Putative competence-damage inducible protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A2RGU9 8.28e-16 77 35 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M5 (strain Manfredo)
Q8NZ29 8.28e-16 77 35 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q1JJH5 8.53e-16 77 35 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9C6 8.53e-16 77 35 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5X9H9 1.26e-15 76 35 2 128 3 cinA Putative competence-damage inducible protein Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5WFW9 1.8e-15 76 35 2 134 3 cinA Putative competence-damage inducible protein Shouchella clausii (strain KSM-K16)
Q5M6H3 4.29e-15 75 37 2 115 3 cinA Putative competence-damage inducible protein Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1Y3 4.42e-15 75 37 2 115 3 cinA Putative competence-damage inducible protein Streptococcus thermophilus (strain CNRZ 1066)
B1YMB8 6.96e-15 74 38 3 136 3 cinA Putative competence-damage inducible protein Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8E2R9 1.01e-14 73 35 1 106 3 cinA Putative competence-damage inducible protein Streptococcus agalactiae serotype III (strain NEM316)
Q3JYN0 1.55e-14 73 34 1 106 3 cinA Putative competence-damage inducible protein Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B9DW66 7.14e-14 71 36 1 116 3 cinA Putative competence-damage inducible protein Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A0LV09 1.12e-12 68 33 2 138 3 Acel_1497 CinA-like protein Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B1HR35 2.1e-12 67 28 3 166 3 cinA Putative competence-damage inducible protein Lysinibacillus sphaericus (strain C3-41)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_15230
Feature type CDS
Gene pncC
Product nicotinamide-nucleotide amidase
Location 57845 - 58366 (strand: 1)
Length 522 (nucleotides) / 173 (amino acids)

Contig

Accession contig_20
Length 84833 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2033
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02464 Competence-damaged protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1546 Coenzyme transport and metabolism (H) H Nicotinamide mononucleotide (NMN) deamidase PncC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03743 nicotinamide-nucleotide amidase [EC:3.5.1.42] Nicotinate and nicotinamide metabolism
Metabolic pathways
-

Protein Sequence

MHDEQALTRRSTELGSYLLEAGLSVTTAESCTGGWIAKVITDIAGSSAYFQRGFVTYSNDAKHSMIGVSEQSLSAFGAVSEAVVREMAAGALDTADADLAVSVSGIAGPDGGSDEKPVGTVWFGWAWREKTGIKTAARSWCFPGDRNAVRCQAVLKGLDGLIAILTKKSLDTV

Flanking regions ( +/- flanking 50bp)

GGCTCTGGGATATCCGCCGCAAAAAACAGATTTCACAACAGGAGTGACCGATGCATGATGAACAGGCTCTGACCCGGCGAAGTACGGAACTGGGATCTTATCTCCTTGAAGCTGGTCTGAGTGTCACAACGGCAGAATCCTGCACCGGCGGGTGGATTGCCAAGGTGATCACAGATATCGCCGGGAGTTCGGCGTATTTTCAGCGCGGATTTGTCACCTACAGTAATGATGCCAAACACAGTATGATCGGCGTATCAGAACAGTCACTGTCCGCCTTTGGTGCGGTCAGTGAGGCGGTGGTCCGCGAAATGGCCGCCGGGGCGCTGGACACTGCGGATGCGGATCTGGCCGTCTCTGTCAGCGGCATTGCCGGGCCGGATGGCGGCAGTGATGAAAAGCCGGTCGGCACAGTCTGGTTCGGCTGGGCGTGGCGGGAAAAAACAGGAATAAAAACCGCGGCCCGCAGCTGGTGTTTTCCGGGCGATCGTAATGCGGTGCGCTGTCAGGCGGTGCTGAAAGGGCTCGACGGATTAATTGCAATTCTGACGAAAAAATCACTTGATACTGTATGACTATACAGTATAATCAGTTCAACAGATTCAGTTGAAACCATTTTAATAAC