Homologs in group_2950

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_15410 EHELCC_15410 100.0 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_15940 NLDBIP_15940 100.0 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_15900 LHKJJB_15900 100.0 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_15020 HKOGLL_15020 100.0 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS07400 F4V73_RS07400 53.7 Morganella psychrotolerans - fimbrial protein

Distribution of the homologs in the orthogroup group_2950

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2950

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P43660 5.09e-12 64 29 7 196 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 5.2e-12 64 29 8 206 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
Q8X5K5 1.28e-10 60 27 7 196 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P37921 3.48e-10 59 28 8 206 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55223 3.19e-09 57 30 9 174 3 None Fimbrial subunit type 1 Salmonella typhimurium
P43664 6.4e-09 56 27 5 184 3 lpfE Protein LpfE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42913 9.82e-08 53 25 7 217 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
Q8X5L0 1.11e-07 52 28 5 153 2 lpfE Probable fimbrial subunit LpfE Escherichia coli O157:H7
P22595 1.9e-07 52 29 7 161 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P21413 3.66e-07 51 32 4 115 3 fasA Fimbrial protein 987P Escherichia coli
P12730 4.03e-07 51 27 3 151 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P11312 5.26e-07 50 29 4 157 3 F17a-A F17 fimbrial protein Escherichia coli
P37909 5.62e-07 50 24 6 204 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P75855 4.96e-06 48 29 5 151 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P39264 7.29e-06 47 23 7 192 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P77789 1.11e-05 47 25 5 152 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
Q8X582 2.45e-05 46 28 5 151 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P62605 6.47e-05 45 27 4 151 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 6.47e-05 45 27 4 151 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45990 0.000196 43 23 7 220 3 hifA Major fimbrial subunit Haemophilus influenzae
P45988 0.000203 43 24 6 221 3 hifA Major fimbrial subunit Haemophilus influenzae
P13429 0.0003 43 26 5 146 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P62607 0.000445 42 36 1 55 3 F7-2 F7-2 fimbrial protein Escherichia coli
P62608 0.000445 42 36 1 55 3 F7-2 F7-2 fimbrial protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39834 0.000593 42 26 8 201 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14605
Feature type CDS
Gene fimA
Product Pilin (type 1 fimbrial protein)
Location 17279 - 17848 (strand: -1)
Length 570 (nucleotides) / 189 (amino acids)
In genomic island -

Contig

Accession contig_19
Length 86773 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2950
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Protein Sequence

MSLFKRKLIISSLLLFSFNAFSADGDVNEIAPEVDTDTKEITGNIRFTGKITDSSCDITQKDKDVYLGEHSVAKLKKNDDRTEEKAFDISLINCSLAMTSLKIKMEGTAHADNATLYALDANEKSAGKVGISIATAEGQQVTPAGDYRDIPLKADSRDYTLNYTAAYQATGLATPGEGNATVNYTVSYE

Flanking regions ( +/- flanking 50bp)

TACATATCATAAGAAACATATATTTGTTGAATATTTAAAAGGTAATTTTTATGTCTTTATTTAAAAGAAAGTTAATTATTTCATCCTTACTTTTATTTTCCTTTAATGCATTCTCTGCGGATGGTGATGTTAATGAAATCGCTCCGGAAGTCGACACCGATACCAAAGAAATAACAGGGAATATCAGATTTACAGGGAAAATCACTGACTCAAGCTGTGATATTACACAAAAAGATAAAGATGTTTATCTGGGCGAGCATTCAGTCGCTAAACTGAAAAAAAATGATGACAGAACGGAAGAAAAAGCCTTTGATATTTCTCTGATTAACTGTTCATTAGCAATGACATCGCTGAAAATCAAAATGGAGGGCACGGCGCATGCAGACAATGCAACGCTGTATGCATTGGATGCCAATGAAAAAAGTGCCGGAAAAGTAGGGATCAGCATTGCGACTGCTGAAGGGCAGCAGGTAACGCCGGCAGGTGATTATCGTGATATTCCGCTAAAGGCCGATTCCCGTGATTATACTCTGAATTATACCGCAGCGTATCAGGCTACCGGCCTGGCAACACCGGGCGAAGGCAATGCAACGGTGAATTACACTGTTTCTTATGAGTAACATTTAATACCGGCGGCAACAGGTGTTGCCGCCCCGGATAAACAGCACCA