Homologs in group_1925

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07955 EHELCC_07955 100.0 Morganella morganii S2 yfcL YfcL protein
NLDBIP_08280 NLDBIP_08280 100.0 Morganella morganii S4 yfcL YfcL protein
LHKJJB_05985 LHKJJB_05985 100.0 Morganella morganii S3 yfcL YfcL protein
HKOGLL_04930 HKOGLL_04930 100.0 Morganella morganii S5 yfcL YfcL protein
F4V73_RS02580 F4V73_RS02580 89.2 Morganella psychrotolerans - YfcL family protein
PMI_RS08820 PMI_RS08820 64.4 Proteus mirabilis HI4320 - YfcL family protein

Distribution of the homologs in the orthogroup group_1925

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1925

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64540 5.49e-35 117 58 0 92 4 yfcL Uncharacterized protein YfcL Escherichia coli (strain K12)
P64541 5.49e-35 117 58 0 92 4 yfcL Uncharacterized protein YfcL Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14325
Feature type CDS
Gene yfcL
Product YfcL protein
Location 65980 - 66261 (strand: -1)
Length 282 (nucleotides) / 93 (amino acids)

Contig

Accession contig_18
Length 100673 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1925
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08891 YfcL protein

Protein Sequence

MLADYETRILAQIDDMVEHATDDELFAGGYLQGHLTLAVAELEQSGDHSVEALHNRVEESIRQAISAGELTPPDQVLVLETWKRLLKTAQEQE

Flanking regions ( +/- flanking 50bp)

ATCCGTTTGCCTGACAAACGATTCCGGTGACTGAACTTTAAGGAACAAACATGCTTGCGGATTATGAAACGCGTATCCTCGCCCAGATTGATGACATGGTCGAACATGCCACAGACGATGAACTGTTTGCGGGCGGCTATCTGCAGGGGCATCTGACCCTCGCGGTGGCAGAACTGGAGCAGTCGGGTGATCACTCCGTTGAGGCGCTTCACAACCGGGTGGAGGAGAGTATCCGTCAGGCAATCAGTGCCGGGGAACTGACACCGCCGGATCAGGTGCTGGTGCTGGAAACCTGGAAACGCCTGCTGAAAACCGCGCAGGAGCAGGAATGACAGCCAAACCGCAATACCGTATCCGCCAGGCCCGTCCGGCGGACGCCGCG