Homologs in group_1867

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11625 EHELCC_11625 100.0 Morganella morganii S2 gloB hydroxyacylglutathione hydrolase
NLDBIP_11970 NLDBIP_11970 100.0 Morganella morganii S4 gloB hydroxyacylglutathione hydrolase
LHKJJB_11830 LHKJJB_11830 100.0 Morganella morganii S3 gloB hydroxyacylglutathione hydrolase
HKOGLL_10440 HKOGLL_10440 100.0 Morganella morganii S5 gloB hydroxyacylglutathione hydrolase
F4V73_RS12810 F4V73_RS12810 78.9 Morganella psychrotolerans gloB hydroxyacylglutathione hydrolase
PMI_RS01085 PMI_RS01085 57.0 Proteus mirabilis HI4320 gloB hydroxyacylglutathione hydrolase

Distribution of the homologs in the orthogroup group_1867

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1867

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JKA9 2.39e-107 313 58 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JR44 1.91e-106 311 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667M5 1.91e-106 311 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KAD1 1.91e-106 311 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFK5 1.91e-106 311 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TL56 6.02e-106 309 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis (strain Pestoides F)
Q1CFI4 6.43e-106 309 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WHW5 6.43e-106 309 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis
Q1CAJ7 6.43e-106 309 57 0 251 3 gloB Hydroxyacylglutathione hydrolase Yersinia pestis bv. Antiqua (strain Antiqua)
Q6D1V5 4.01e-104 305 54 0 251 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BEP2 4.96e-103 302 56 0 251 3 gloB Hydroxyacylglutathione hydrolase Edwardsiella ictaluri (strain 93-146)
C6DC67 5.06e-101 297 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7N809 9.42e-101 296 58 1 251 3 gloB Hydroxyacylglutathione hydrolase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GA75 3.89e-98 290 56 0 251 3 gloB Hydroxyacylglutathione hydrolase Serratia proteamaculans (strain 568)
A6T510 3.25e-96 285 51 0 251 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y1G4 1.16e-95 283 50 0 251 3 gloB Hydroxyacylglutathione hydrolase Klebsiella pneumoniae (strain 342)
A4W6V2 1.79e-94 280 51 0 251 3 gloB Hydroxyacylglutathione hydrolase Enterobacter sp. (strain 638)
Q8Z983 4.16e-94 279 51 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella typhi
C4K7Z9 5.4e-94 279 51 1 251 3 gloB Hydroxyacylglutathione hydrolase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B7MQ21 5.85e-93 276 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O81 (strain ED1a)
B7N874 6.67e-93 276 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FKY7 9.15e-93 276 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1RFX9 1.08e-92 276 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain UTI89 / UPEC)
B2VHJ7 1.58e-92 275 55 0 251 3 gloB Hydroxyacylglutathione hydrolase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1A7Q3 1.82e-92 275 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O1:K1 / APEC
B7MBI8 1.82e-92 275 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q2NVG1 1.86e-92 275 51 3 253 3 gloB Hydroxyacylglutathione hydrolase Sodalis glossinidius (strain morsitans)
Q0TLC5 3.25e-92 275 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UJA8 3.25e-92 275 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LW87 3.39e-92 275 53 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
C0Q6N0 3.18e-91 272 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi C (strain RKS4594)
B6HZS5 3.59e-91 272 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SE11)
B1LHM1 6.07e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKW6 6.07e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7M211 6.41e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O8 (strain IAI1)
B7LHB8 6.41e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain 55989 / EAEC)
Q3Z5F1 6.55e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella sonnei (strain Ss046)
B2U350 6.55e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A7ZHU8 6.55e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O139:H28 (strain E24377A / ETEC)
P0AC84 7.3e-91 271 52 0 251 1 gloB Hydroxyacylglutathione hydrolase GloB Escherichia coli (strain K12)
A7ZWF4 7.3e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O9:H4 (strain HS)
B1XD76 7.3e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / DH10B)
C4ZRU9 7.3e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z0I6 7.3e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AC85 7.3e-91 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli O157:H7
B5BDW7 1.06e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain AKU_12601)
Q5PFD6 1.06e-90 271 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZRM2 1.33e-90 270 52 0 251 1 gloB Hydroxyacylglutathione hydrolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83MC1 1.41e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri
Q0T802 1.41e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella flexneri serotype 5b (strain 8401)
Q325T4 1.41e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella boydii serotype 4 (strain Sb227)
B5R5L1 2.02e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4TYG8 2.08e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella schwarzengrund (strain CVM19633)
A9MZ21 2.08e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SV37 2.08e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella newport (strain SL254)
B4TK83 2.08e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella heidelberg (strain SL476)
Q57SZ8 2.08e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella choleraesuis (strain SC-B67)
B5F8X0 2.08e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella agona (strain SL483)
B1IPU6 3.15e-90 270 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8AKR2 1.66e-89 268 50 0 251 3 gloB Hydroxyacylglutathione hydrolase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5R447 2.74e-89 267 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella enteritidis PT4 (strain P125109)
B5FJ56 2.74e-89 267 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella dublin (strain CT_02021853)
Q32JQ1 5.88e-89 266 52 0 251 3 gloB Hydroxyacylglutathione hydrolase Shigella dysenteriae serotype 1 (strain Sd197)
A9MPF3 9.12e-87 261 50 0 251 3 gloB Hydroxyacylglutathione hydrolase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7MI37 1.68e-85 258 49 0 251 3 gloB Hydroxyacylglutathione hydrolase Cronobacter sakazakii (strain ATCC BAA-894)
B6EJV4 3.15e-81 247 49 1 252 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio salmonicida (strain LFI1238)
Q6LN63 3.73e-79 241 50 0 246 3 gloB Hydroxyacylglutathione hydrolase Photobacterium profundum (strain SS9)
B5F9V3 1.75e-78 239 47 0 246 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain MJ11)
Q1LT01 1.89e-78 240 46 1 251 3 gloB Hydroxyacylglutathione hydrolase Baumannia cicadellinicola subsp. Homalodisca coagulata
P57336 2e-78 239 44 1 249 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q5E3G3 2.13e-78 239 47 0 246 3 gloB Hydroxyacylglutathione hydrolase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4SPI6 6.48e-78 238 49 3 252 3 gloB Hydroxyacylglutathione hydrolase Aeromonas salmonicida (strain A449)
Q08889 1.68e-77 237 43 1 251 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q87MG0 3.1e-76 234 45 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8PBY0 4.98e-75 231 47 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RTE9 4.98e-75 231 47 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain B100)
Q4URM1 4.98e-75 231 47 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas campestris pv. campestris (strain 8004)
C3LPP0 7.89e-75 230 44 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPX6 7.89e-75 230 44 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F635 7.89e-75 230 44 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MY07 9.28e-75 230 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio campbellii (strain ATCC BAA-1116)
Q8DBD8 6.18e-74 228 45 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio vulnificus (strain CMCP6)
Q7MII4 6.18e-74 228 45 0 251 3 gloB2 Hydroxyacylglutathione hydrolase 2 Vibrio vulnificus (strain YJ016)
Q3BWP5 1.46e-73 227 45 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B7VIP5 3.38e-73 226 43 0 251 3 gloB Hydroxyacylglutathione hydrolase Vibrio atlanticus (strain LGP32)
A0KIK2 5.62e-73 226 50 4 254 3 gloB Hydroxyacylglutathione hydrolase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1U0V1 2.19e-72 224 44 4 263 3 gloB Hydroxyacylglutathione hydrolase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8PNI0 2.41e-72 224 45 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas axonopodis pv. citri (strain 306)
B1WUT9 5.81e-72 223 45 4 261 3 gloB Hydroxyacylglutathione hydrolase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A1SS88 2.13e-71 222 45 5 255 3 gloB Hydroxyacylglutathione hydrolase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q46Z82 5.23e-71 221 43 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5QZL0 1.63e-70 219 44 4 255 3 gloB Hydroxyacylglutathione hydrolase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B3R1Y0 2.27e-70 219 45 6 262 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q3IIR9 6.53e-70 218 45 3 257 3 gloB Hydroxyacylglutathione hydrolase Pseudoalteromonas translucida (strain TAC 125)
Q21YF8 7.07e-70 218 46 6 258 3 gloB Hydroxyacylglutathione hydrolase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q89AN4 1.41e-69 217 39 1 250 3 gloB Hydroxyacylglutathione hydrolase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2P6Y4 4.3e-69 216 45 1 253 3 gloB Hydroxyacylglutathione hydrolase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A6WMW5 4.44e-69 216 46 4 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS185)
A3D437 3.17e-68 214 45 4 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q493H8 3.97e-68 213 39 0 251 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella pennsylvanica (strain BPEN)
Q3KE79 5.36e-68 213 49 5 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain Pf0-1)
Q8D3D4 5.57e-68 213 43 3 253 3 gloB Hydroxyacylglutathione hydrolase Wigglesworthia glossinidia brevipalpis
B8E5A2 8.17e-68 213 45 4 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS223)
Q1LL91 4.67e-67 211 42 5 260 3 gloB Hydroxyacylglutathione hydrolase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4XU09 4.8e-67 211 46 5 257 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas mendocina (strain ymp)
Q48KX8 7.88e-67 210 45 5 254 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87YS8 1.8e-66 209 45 5 254 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P72933 3.01e-66 209 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DIF1 3.46e-66 208 44 4 256 3 gloB Hydroxyacylglutathione hydrolase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q4ZVL3 3.53e-66 209 44 5 254 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas syringae pv. syringae (strain B728a)
C3K9Q0 8.12e-66 207 47 5 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain SBW25)
B2IVH7 1.16e-65 207 43 4 261 3 gloB Hydroxyacylglutathione hydrolase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B7KEB4 1.26e-65 207 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Gloeothece citriformis (strain PCC 7424)
A9L0E9 1.99e-65 207 45 4 262 3 gloB Hydroxyacylglutathione hydrolase Shewanella baltica (strain OS195)
Q9PBI4 2.06e-65 207 43 3 261 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain 9a5c)
Q5N5S6 2.53e-65 206 43 4 262 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31ND6 2.53e-65 206 43 4 262 3 gloB Hydroxyacylglutathione hydrolase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B0U365 3.74e-65 206 44 3 261 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M12)
Q2JVC3 4.26e-65 206 44 4 256 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-3-3Ab)
Q1QW62 4.67e-65 206 47 3 255 3 gloB Hydroxyacylglutathione hydrolase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B1XQ70 5.22e-65 206 43 4 263 3 gloB Hydroxyacylglutathione hydrolase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q87C74 6.64e-65 205 43 3 261 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5S5 6.64e-65 205 43 3 261 3 gloB Hydroxyacylglutathione hydrolase Xylella fastidiosa (strain M23)
A4G7G5 7.55e-65 205 42 5 259 3 gloB Hydroxyacylglutathione hydrolase Herminiimonas arsenicoxydans
Q0AE32 8.48e-65 205 43 4 255 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A0KXS9 1.69e-64 204 43 5 266 3 gloB Hydroxyacylglutathione hydrolase Shewanella sp. (strain ANA-3)
Q4KBH9 1.92e-64 204 46 5 256 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0KN02 3.06e-64 204 45 8 265 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain GB-1)
B4SLN7 3.85e-64 203 41 2 253 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain R551-3)
Q2JPX4 3.9e-64 203 44 4 256 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q9CMW8 5.34e-64 202 41 2 249 3 gloB Hydroxyacylglutathione hydrolase Pasteurella multocida (strain Pm70)
Q1I7T2 6.14e-64 203 45 5 259 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas entomophila (strain L48)
A5W167 7.15e-64 202 44 7 264 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8EE27 1.42e-63 202 44 7 270 3 gloB Hydroxyacylglutathione hydrolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1S6T3 1.8e-63 202 42 4 259 3 gloB Hydroxyacylglutathione hydrolase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q10Y41 2.01e-63 201 40 4 261 3 gloB Hydroxyacylglutathione hydrolase Trichodesmium erythraeum (strain IMS101)
Q88FF3 2.63e-63 201 45 8 269 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3MGD2 3.95e-63 201 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q12MM2 7.8e-63 200 41 4 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0JW10 1.18e-62 199 42 4 261 3 gloB Hydroxyacylglutathione hydrolase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q47FN7 1.21e-62 200 42 5 266 3 gloB Hydroxyacylglutathione hydrolase Dechloromonas aromatica (strain RCB)
B2FR57 2.77e-62 199 41 2 253 3 gloB Hydroxyacylglutathione hydrolase Stenotrophomonas maltophilia (strain K279a)
Q7NG34 4.3e-62 198 43 4 256 3 gloB Hydroxyacylglutathione hydrolase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B7K3R6 5.63e-62 198 41 4 261 3 gloB Hydroxyacylglutathione hydrolase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q8YZ99 6.42e-62 197 41 5 261 3 gloB Hydroxyacylglutathione hydrolase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1H188 7.19e-62 197 42 5 254 3 gloB Hydroxyacylglutathione hydrolase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A3QET2 1.22e-61 197 43 5 253 3 gloB Hydroxyacylglutathione hydrolase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q65U07 2.55e-61 196 42 4 254 3 gloB Hydroxyacylglutathione hydrolase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B1JBN3 3.51e-61 196 43 6 259 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas putida (strain W619)
A9BEI3 3.56e-61 196 39 4 256 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9211)
A6VNK4 1.32e-60 194 41 2 246 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QJZ3 1.69e-60 193 41 3 251 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain 86-028NP)
Q7VQB7 3.41e-60 193 36 1 252 3 gloB Hydroxyacylglutathione hydrolase Blochmanniella floridana
A6V707 3.66e-60 193 45 6 259 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain PA7)
A8H589 8.5e-60 192 43 5 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A4Y6B8 1.04e-59 192 42 6 269 3 gloB Hydroxyacylglutathione hydrolase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q2SJ47 2.34e-59 191 42 3 256 3 gloB Hydroxyacylglutathione hydrolase Hahella chejuensis (strain KCTC 2396)
B8HMJ9 4.04e-59 191 43 4 260 3 gloB Hydroxyacylglutathione hydrolase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A1RK78 5.3e-59 191 42 6 269 3 gloB Hydroxyacylglutathione hydrolase Shewanella sp. (strain W3-18-1)
Q2RP80 1.44e-58 189 41 5 256 3 gloB Hydroxyacylglutathione hydrolase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B0BZI8 1.56e-58 189 40 4 261 3 gloB Hydroxyacylglutathione hydrolase Acaryochloris marina (strain MBIC 11017)
Q7VM19 2.09e-58 188 40 5 252 3 gloB Hydroxyacylglutathione hydrolase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A2BQ40 2.13e-58 188 38 4 252 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain AS9601)
Q0A751 4.06e-58 188 43 5 255 3 gloB Hydroxyacylglutathione hydrolase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q82XW0 4.31e-58 188 41 4 255 3 gloB Hydroxyacylglutathione hydrolase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5ZVZ3 4.75e-58 187 40 5 256 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q9I2T1 6.44e-58 187 44 6 259 1 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5WX41 6.51e-58 187 40 5 256 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Lens)
A5IBE7 6.51e-58 187 40 5 256 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Corby)
B7VB64 9.82e-58 187 44 6 259 3 gloB Hydroxyacylglutathione hydrolase Pseudomonas aeruginosa (strain LESB58)
P71374 1.19e-57 186 39 4 256 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0TRL8 1.34e-57 187 42 4 257 3 gloB Hydroxyacylglutathione hydrolase Shewanella halifaxensis (strain HAW-EB4)
Q5X5R2 2.87e-57 186 40 5 256 3 gloB Hydroxyacylglutathione hydrolase Legionella pneumophila (strain Paris)
B8F6A3 5.24e-57 184 40 4 252 3 gloB Hydroxyacylglutathione hydrolase Glaesserella parasuis serovar 5 (strain SH0165)
A1WXD9 7.59e-57 185 41 4 248 3 gloB Hydroxyacylglutathione hydrolase Halorhodospira halophila (strain DSM 244 / SL1)
A5UF43 9.03e-57 184 39 4 261 3 gloB Hydroxyacylglutathione hydrolase Haemophilus influenzae (strain PittGG)
Q8LDW8 9.39e-57 187 39 5 256 2 GLX2-4 Probable hydroxyacylglutathione hydrolase 2, chloroplastic Arabidopsis thaliana
Q31BX5 1.68e-56 183 37 4 252 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9312)
A6VVZ9 1.76e-56 184 40 5 258 3 gloB Hydroxyacylglutathione hydrolase Marinomonas sp. (strain MWYL1)
Q7VD23 2.6e-56 183 39 3 226 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A3PBT3 6.72e-56 182 37 4 252 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9301)
B0BTR9 1.16e-55 181 41 4 252 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H0S9 1.16e-55 181 41 4 252 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9SID3 1.21e-55 184 38 5 256 1 At2g31350 Hydroxyacylglutathione hydrolase 2, mitochondrial Arabidopsis thaliana
A3MZD3 1.26e-55 181 41 4 252 3 gloB Hydroxyacylglutathione hydrolase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7V6G8 8.11e-55 179 37 4 253 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9313)
Q7U5Z8 4.45e-54 177 39 7 264 3 gloB Hydroxyacylglutathione hydrolase Parasynechococcus marenigrum (strain WH8102)
Q0AM20 5.51e-54 177 40 6 255 3 gloB Hydroxyacylglutathione hydrolase Maricaulis maris (strain MCS10)
Q60BX0 5.95e-54 177 39 5 256 3 gloB Hydroxyacylglutathione hydrolase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5GJK5 7.57e-54 177 40 3 227 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain WH7803)
Q3AL08 9.08e-54 177 38 5 256 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9605)
Q3AYI2 1.57e-53 176 37 6 264 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9902)
Q6G1L3 1.64e-53 176 41 6 248 3 gloB Hydroxyacylglutathione hydrolase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q0I3Q7 4.29e-53 174 36 2 249 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 129Pt)
B0UU01 6.83e-53 174 36 2 249 3 gloB Hydroxyacylglutathione hydrolase Histophilus somni (strain 2336)
Q0I8S8 7.77e-53 174 37 5 258 3 gloB Hydroxyacylglutathione hydrolase Synechococcus sp. (strain CC9311)
Q3SIB0 1.08e-52 174 39 4 255 3 gloB Hydroxyacylglutathione hydrolase Thiobacillus denitrificans (strain ATCC 25259)
Q6ML19 1.12e-52 174 41 7 236 3 gloB Hydroxyacylglutathione hydrolase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A2C116 3.68e-52 172 38 5 256 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL1A)
Q46GM1 3.89e-52 172 38 5 256 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain NATL2A)
C4LC58 4.59e-52 172 40 5 260 3 gloB Hydroxyacylglutathione hydrolase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A9IZW8 9.78e-52 171 38 5 247 3 gloB Hydroxyacylglutathione hydrolase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A2C7W3 1.69e-51 171 39 5 234 3 gloB Hydroxyacylglutathione hydrolase Prochlorococcus marinus (strain MIT 9303)
Q9JXK4 6.23e-51 169 40 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0M3 6.23e-51 169 40 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup C (strain 053442)
A1KW76 7.24e-51 169 40 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A4YKS8 1.26e-50 169 39 6 253 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain ORS 278)
Q21J46 1.55e-50 169 37 8 257 3 gloB Hydroxyacylglutathione hydrolase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5LNN5 2.48e-50 168 37 5 257 3 gloB Hydroxyacylglutathione hydrolase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q11DS3 2.51e-50 168 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Chelativorans sp. (strain BNC1)
Q6FYC3 3.34e-50 167 39 5 247 3 gloB Hydroxyacylglutathione hydrolase Bartonella quintana (strain Toulouse)
Q6NC62 3.94e-50 167 39 6 253 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2J429 2.08e-49 166 37 6 253 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain HaA2)
Q162S3 4.98e-49 164 37 5 256 3 gloB Hydroxyacylglutathione hydrolase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5F7J0 7.74e-49 164 39 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q89XT5 1.05e-48 164 37 5 254 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B4RJC7 2.56e-48 162 39 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria gonorrhoeae (strain NCCP11945)
A6WXE0 2.62e-48 163 37 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1IPQ8 3.51e-48 162 39 5 257 3 gloB Hydroxyacylglutathione hydrolase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A5ETG1 4.69e-48 162 39 6 253 3 gloB Hydroxyacylglutathione hydrolase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q13F06 6.35e-48 162 36 6 252 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB5)
Q3SVQ1 8.13e-48 161 39 5 247 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q2N9P7 1.08e-47 161 40 7 257 3 gloB Hydroxyacylglutathione hydrolase Erythrobacter litoralis (strain HTCC2594)
P05446 1.32e-47 161 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Fuscovulum blasticum
Q21C03 1.64e-47 160 38 5 254 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisB18)
O24496 3.44e-47 160 36 5 260 1 GLX2-2 Hydroxyacylglutathione hydrolase cytoplasmic Arabidopsis thaliana
Q4FP49 4.02e-47 159 35 4 255 3 gloB Hydroxyacylglutathione hydrolase Pelagibacter ubique (strain HTCC1062)
Q31H51 5.92e-47 160 36 5 259 3 gloB Hydroxyacylglutathione hydrolase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8FYE7 9.2e-47 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella suis biovar 1 (strain 1330)
A5VSR1 9.2e-47 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YJF4 9.2e-47 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57AW2 9.2e-47 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus biovar 1 (strain 9-941)
Q2YLU8 9.2e-47 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain 2308)
B0CIU0 1.05e-46 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RFI1 1.05e-46 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8S2 1.05e-46 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B2S889 1.05e-46 159 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Brucella abortus (strain S19)
O24495 1.33e-46 160 35 5 246 2 GLX2-1 Hydroxyacylglutathione hydrolase 1, mitochondrial Arabidopsis thaliana
Q28TK3 4.22e-46 157 38 6 257 3 gloB Hydroxyacylglutathione hydrolase Jannaschia sp. (strain CCS1)
Q6P963 5.64e-46 158 35 6 262 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Danio rerio
Q0BWR4 6.15e-46 157 35 5 256 3 gloB Hydroxyacylglutathione hydrolase Hyphomonas neptunium (strain ATCC 15444)
Q7MQ55 9.25e-46 156 33 4 245 3 gloB1 Hydroxyacylglutathione hydrolase 1 Vibrio vulnificus (strain YJ016)
Q92MF8 2.72e-45 155 36 5 256 3 gloB Hydroxyacylglutathione hydrolase Rhizobium meliloti (strain 1021)
Q3B7M2 6.4e-45 155 35 5 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Bos taurus
Q1QQZ1 8.09e-45 154 40 4 221 3 gloB Hydroxyacylglutathione hydrolase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q98G02 1.05e-44 154 35 5 256 3 gloB Hydroxyacylglutathione hydrolase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q07VA9 3.27e-44 152 37 5 254 3 gloB Hydroxyacylglutathione hydrolase Rhodopseudomonas palustris (strain BisA53)
B4F6K2 8.84e-44 153 35 6 262 2 hagh Hydroxyacylglutathione hydrolase, mitochondrial Xenopus tropicalis
Q5ZLY2 1.11e-43 152 37 8 265 2 HAGHL Hydroxyacylglutathione hydrolase-like protein Gallus gallus
Q5ZI23 1.21e-43 152 35 6 262 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Gallus gallus
O35952 2.62e-43 151 34 6 260 1 Hagh Hydroxyacylglutathione hydrolase, mitochondrial Rattus norvegicus
A4WUN2 6.5e-43 149 36 6 261 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A7YY46 2.86e-42 150 37 3 239 2 PNKD Probable hydrolase PNKD Bos taurus
A3PIB4 3.39e-42 147 35 6 268 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q4R6C1 4.2e-42 148 34 5 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Macaca fascicularis
Q3J436 4.68e-42 147 34 6 268 3 gloB Hydroxyacylglutathione hydrolase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q99KB8 4.74e-42 148 34 6 260 1 Hagh Hydroxyacylglutathione hydrolase, mitochondrial Mus musculus
Q16775 2.1e-41 146 34 5 260 1 HAGH Hydroxyacylglutathione hydrolase, mitochondrial Homo sapiens
Q8N490 2.22e-41 148 37 3 236 1 PNKD Probable hydrolase PNKD Homo sapiens
Q69ZP3 2.14e-40 146 35 4 262 1 Pnkd Probable hydrolase PNKD Mus musculus
Q28333 1.27e-39 141 33 5 260 2 HAGH Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) Callithrix jacchus
B0UBD0 3.88e-39 139 35 5 247 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium sp. (strain 4-46)
P96981 1.04e-38 138 41 4 255 3 gloB Hydroxyacylglutathione hydrolase Rhodobacter capsulatus
A5FZE9 1.51e-38 137 37 6 252 3 gloB Hydroxyacylglutathione hydrolase Acidiphilium cryptum (strain JF-5)
Q8U9W1 1.94e-38 137 34 6 247 3 gloB Hydroxyacylglutathione hydrolase Agrobacterium fabrum (strain C58 / ATCC 33970)
B8ICA2 5.46e-38 136 34 5 247 3 gloB Hydroxyacylglutathione hydrolase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q54MR1 6.45e-36 131 34 6 233 3 hagh Hydroxyacylglutathione hydrolase Dictyostelium discoideum
Q9DB32 8.37e-36 131 35 4 227 1 Haghl Hydroxyacylglutathione hydrolase-like protein Mus musculus
Q2K3M6 1.67e-35 130 35 6 256 3 gloB Hydroxyacylglutathione hydrolase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9UT36 8.81e-35 128 35 7 218 3 glo2 Probable hydroxyacylglutathione hydrolase glo2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O94250 1.53e-34 127 32 9 252 3 SPCC13B11.03c Probable hydroxyacylglutathione hydrolase SPCC13B11.03c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B0TXY0 5.55e-34 125 31 5 244 3 gloB Hydroxyacylglutathione hydrolase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q1MB56 8.06e-34 125 39 4 185 3 gloB Hydroxyacylglutathione hydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q26547 1.33e-33 124 33 7 242 2 None Probable hydroxyacylglutathione hydrolase Schistosoma mansoni
Q6PII5 3.73e-31 119 35 3 199 1 HAGHL Hydroxyacylglutathione hydrolase-like protein Homo sapiens
A0Q7M7 5.91e-30 115 30 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. novicida (strain U112)
Q0BMS2 2.24e-29 114 30 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A4E2 2.24e-29 114 30 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain LVS)
A7NB16 2.24e-29 114 30 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IWV0 7.04e-28 110 29 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NF43 7.04e-28 110 29 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SFR3 7.04e-28 110 29 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14GJ6 7.04e-28 110 29 6 245 3 gloB Hydroxyacylglutathione hydrolase Francisella tularensis subsp. tularensis (strain FSC 198)
Q051W5 1.05e-26 107 30 11 271 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RQ6 1.05e-26 107 30 11 271 3 gloB Hydroxyacylglutathione hydrolase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q2IJC6 3.74e-26 105 34 8 256 3 gloB Hydroxyacylglutathione hydrolase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q12BV7 9.34e-24 99 30 6 239 3 gloB Hydroxyacylglutathione hydrolase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3JAC4 1.1e-23 99 31 6 208 3 gloB Hydroxyacylglutathione hydrolase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q05584 4.03e-23 97 29 10 266 1 GLO2 Hydroxyacylglutathione hydrolase, cytoplasmic isozyme Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P75849 4.43e-20 88 32 8 200 1 gloC Hydroxyacylglutathione hydrolase GloC Escherichia coli (strain K12)
P54501 1.22e-18 84 31 8 186 3 yqgX Probable metallo-hydrolase YqgX Bacillus subtilis (strain 168)
Q12320 1.28e-14 75 27 8 234 1 GLO4 Hydroxyacylglutathione hydrolase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9C8L4 1.95e-14 74 26 8 235 1 GLY3 Persulfide dioxygenase ETHE1 homolog, mitochondrial Arabidopsis thaliana
Q49649 3.14e-13 70 34 9 185 3 ML0493 Uncharacterized protein ML0493 Mycobacterium leprae (strain TN)
Q57544 4.83e-13 69 27 9 194 3 gloC Hydroxyacylglutathione hydrolase GloC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7Z4X7 5.71e-13 69 30 7 169 1 baeB Probable polyketide biosynthesis zinc-dependent hydrolase BaeB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O67893 1.65e-12 67 27 10 205 3 aq_2135 Uncharacterized protein aq_2135 Aquifex aeolicus (strain VF5)
Q8SSH0 2.35e-12 68 22 5 205 1 ECU02_0580 Probable hydroxyacylglutathione hydrolase ECU02_0580 Encephalitozoon cuniculi (strain GB-M1)
Q9PFB0 1.25e-11 67 29 7 181 2 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain 9a5c)
Q87AD6 2.1e-11 66 29 6 181 3 blh Beta-lactamase hydrolase-like protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q0VBY3 4.56e-11 63 31 2 119 2 HAGHL Hydroxyacylglutathione hydrolase-like protein Bos taurus
P64262 6.09e-11 63 33 9 181 3 BQ2027_MB2612C Uncharacterized protein Mb2612c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMW3 6.09e-11 63 33 9 181 1 Rv2581c Uncharacterized protein Rv2581c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMW2 6.09e-11 63 33 9 181 3 MT2658 Uncharacterized protein MT2658 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
M3ANL0 2.09e-09 60 31 3 105 2 MYCFIDRAFT_190111 Atrochrysone carboxyl ACP thioesterase MYCFIDRAFT_190111 Pseudocercospora fijiensis (strain CIRAD86)
O34769 2.17e-09 59 28 6 152 1 pksB Probable polyketide biosynthesis zinc-dependent hydrolase PksB Bacillus subtilis (strain 168)
O95571 3.43e-09 59 29 6 167 1 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Homo sapiens
Q8UAA9 4.07e-09 59 26 10 245 2 blh Beta-lactamase hydrolase-like protein Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3T094 4.16e-09 58 30 6 166 2 ETHE1 Persulfide dioxygenase ETHE1, mitochondrial Bos taurus
E1ACR1 4.77e-09 59 32 5 124 1 notP Lactamase-like protein notP Aspergillus sp. (strain MF297-2)
Q54EJ5 6.01e-09 58 26 4 160 3 gloB2 Glyoxylase B2 Dictyostelium discoideum
Q9DCM0 8.3e-09 58 31 7 171 1 Ethe1 Persulfide dioxygenase ETHE1, mitochondrial Mus musculus
P0CU68 8.84e-09 58 31 4 122 1 claF Atrochrysone carboxyl ACP thioesterase Passalora fulva
A0A5B8YUX5 1.08e-08 58 30 3 125 2 GME11357 Lactamase-like protein GME11357 Pestalotiopsis microspora
D7PHZ8 2.27e-08 57 30 4 138 1 vrtG Lactamase-like protein vrtG Penicillium aethiopicum
Q0CCY4 2.43e-08 57 30 3 117 1 gedB Atrochrysone carboxyl ACP thioesterase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q4WA58 2.45e-08 57 30 4 118 3 nscB Lactamase-like protein nscB Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A1D8J2 2.55e-08 57 30 4 118 3 nscB Lactamase-like protein nscB Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q5AXB0 7.03e-08 55 29 3 124 1 pkgB Thioesterase pkgB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5B0C9 1.05e-07 55 27 4 122 1 aptB Lactamase-like protein aptB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C5FM60 1.52e-07 55 32 3 101 3 nscB Lactamase-like protein nscB Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
Q6NYF0 1.96e-07 54 29 7 150 2 lactb2 Endoribonuclease LACTB2 Danio rerio
A0A1L9WLF1 3.01e-07 53 30 2 98 1 AacuM Atrochrysone carboxyl ACP thioesterase AacuM Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q5BH31 3.47e-07 53 29 5 123 3 mdpF Atrochrysone carboxyl ACP thioesterase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A067XMV3 4.43e-07 53 27 3 120 2 ptaB Lactamase-like protein ptaB Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
G3KLH5 7.2e-07 52 31 4 118 1 adaB Lactamase-like protein adaB Aspergillus niger
A2QX23 7.2e-07 52 31 4 118 1 adaB Lactamase-like protein adaB Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A0A4P8DJU1 8.4e-07 52 28 3 117 3 dmxR1 Atrochrysone carboxyl ACP thioesterase dmxR1 Cryptosporiopsis sp. (strain 8999)
E4V2N5 1.29e-06 52 33 2 89 3 nscB Lactamase-like protein nscB Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
P52700 1.75e-06 51 32 5 128 1 None Metallo-beta-lactamase L1 type 3 Stenotrophomonas maltophilia
M1WCF7 1.88e-06 51 29 2 105 2 CPUR_05436 Atrochrysone carboxyl ACP thioesterase CPUR_05436 Claviceps purpurea (strain 20.1)
Q5XGR8 2.4e-06 51 33 4 104 2 lactb2 Endoribonuclease LACTB2 Xenopus laevis
A0A7R7ZLL0 2.94e-06 50 27 3 116 3 AcTE Atrochrysone carboxyl ACP thioesterase Aspergillus chevalieri
Q4WQZ6 5.59e-06 50 28 3 120 2 tpcB Atrochrysone carboxyl ACP thioesterase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q0V9A9 6.39e-06 49 31 4 128 2 lactb2 Endoribonuclease LACTB2 Xenopus tropicalis
Q95Q18 8.62e-06 49 31 4 98 3 Y53F4B.39 Beta-lactamase-like protein 2 homolog Caenorhabditis elegans
Q561R9 8.65e-06 49 32 4 104 2 Lactb2 Endoribonuclease LACTB2 Rattus norvegicus
P37502 1.19e-05 48 27 5 137 3 yybB Probable metallo-hydrolase YybB Bacillus subtilis (strain 168)
Q1LZ83 1.76e-05 48 34 5 106 2 LACTB2 Endoribonuclease LACTB2 Bos taurus
A0A2I1C3U0 1.93e-05 48 29 3 120 1 nsrC Atrochrysone carboxyl ACP thioesterase nsrC Aspergillus novofumigatus (strain IBT 16806)
A0A411PQM3 2.13e-05 48 27 3 109 3 AgnL7 Atrochrysone carboxyl ACP thioesterase AgnL7 Paecilomyces divaricatus
Q53H82 3.97e-05 47 26 8 172 1 LACTB2 Endoribonuclease LACTB2 Homo sapiens
F2S702 8.95e-05 46 29 3 91 3 nscB Lactamase-like protein nscB Trichophyton tonsurans (strain CBS 112818)
F2PWS8 8.95e-05 46 29 3 91 3 nscB Lactamase-like protein nscB Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q99KR3 9.18e-05 46 29 4 104 1 Lactb2 Endoribonuclease LACTB2 Mus musculus
P54435 0.000112 46 25 6 162 4 yrkH Uncharacterized protein YrkH Bacillus subtilis (strain 168)
Q4W945 0.000116 46 28 3 101 1 encB Atrochrysone carboxyl ACP thioesterase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
D4CZZ5 0.000154 45 31 3 93 3 nscB Lactamase-like protein nscB Trichophyton verrucosum (strain HKI 0517)
Q3JRV4 0.000195 45 27 7 182 1 BURPS1710b_2304 Probable metallo-hydrolase BURPS1710b_2304 Burkholderia pseudomallei (strain 1710b)
F2T0M3 0.000531 44 28 3 91 3 nscB Lactamase-like protein nscB Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
D4AWH0 0.000605 44 29 3 93 3 nscB Lactamase-like protein nscB Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13955
Feature type CDS
Gene gloB
Product hydroxyacylglutathione hydrolase
Location 84066 - 84821 (strand: 1)
Length 756 (nucleotides) / 251 (amino acids)

Contig

Accession contig_17
Length 103646 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1867
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00753 Metallo-beta-lactamase superfamily
PF16123 Hydroxyacylglutathione hydrolase C-terminus

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0491 General function prediction only (R) R Glyoxylase or a related metal-dependent hydrolase, beta-lactamase superfamily II

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01069 hydroxyacylglutathione hydrolase [EC:3.1.2.6] Pyruvate metabolism
Metabolic pathways		 -

Protein Sequence

MELIRISALSDNYIWLLRDNAHTCVIVDPGVSEPVLNTLRERGLTPSAILLTHHHADHTGGTAEIVSHYPGLPVYGPAETLAKGANHCVQDNDIITCGGLTFQVMAVPGHTLGHVAYYCEPYLFCGDTLFSGGCGRIFEGTPAQMFRSVSRLAALPDETLVCCAHEYTQSNLAFARAVWPENRDIQAYQQYIAELRQNHEATLPVTLKTERKINVFLNCDNIDLQHNLSVSKHTATAEETFTSLRAKKDQF

Flanking regions ( +/- flanking 50bp)

CAGAAAACATGGCTTTATCCTTGGTTCACACTCAGAAAGGTGAGGTATCTATGGAGCTTATCAGAATTTCCGCGTTATCAGATAACTACATTTGGCTATTACGGGATAATGCGCACACCTGTGTCATCGTTGACCCCGGCGTCAGTGAGCCGGTACTGAATACACTGCGGGAGCGGGGACTGACCCCTTCAGCCATCCTGCTGACACACCACCATGCGGATCACACCGGCGGCACGGCGGAGATTGTGTCACATTATCCCGGCCTGCCGGTTTACGGCCCCGCCGAAACCCTGGCGAAAGGCGCAAATCACTGCGTGCAGGATAATGACATTATCACCTGCGGCGGGCTGACATTTCAGGTCATGGCCGTACCGGGGCATACACTCGGTCATGTGGCCTATTATTGCGAACCTTATCTGTTTTGCGGCGATACGCTCTTCTCCGGTGGCTGCGGCCGTATTTTTGAGGGCACACCGGCACAGATGTTCCGTTCAGTCAGCCGCCTTGCGGCGCTGCCGGATGAGACGCTGGTCTGCTGTGCGCATGAATATACACAGTCTAACCTCGCCTTTGCGCGCGCTGTCTGGCCGGAAAACCGTGATATTCAGGCATATCAGCAATATATTGCAGAATTACGTCAGAATCATGAAGCTACACTGCCCGTCACACTGAAAACAGAAAGGAAAATTAATGTTTTTCTTAACTGTGATAATATTGATCTGCAACATAATTTATCAGTAAGTAAACATACGGCGACGGCTGAGGAAACTTTTACGTCTTTACGCGCAAAAAAAGATCAATTTTAGCCGTAATCGTTGTCAGGGCGGAATAACACCAGTATGATTGCAAAACCTAC