Homologs in group_1704

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11240 FBDBKF_11240 53.7 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
EHELCC_17975 EHELCC_17975 53.7 Morganella morganii S2 - HTH cro/C1-type domain-containing protein
NLDBIP_05305 NLDBIP_05305 53.7 Morganella morganii S4 - HTH cro/C1-type domain-containing protein
LHKJJB_02185 LHKJJB_02185 53.7 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
HKOGLL_15565 HKOGLL_15565 53.7 Morganella morganii S5 - HTH cro/C1-type domain-containing protein
PMI_RS02380 PMI_RS02380 52.9 Proteus mirabilis HI4320 - S24 family peptidase

Distribution of the homologs in the orthogroup group_1704

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1704

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P18680 8.39e-47 153 58 0 121 4 CI-HTT 26 kDa repressor protein Escherichia phage HK022
P44207 8.86e-09 54 33 2 104 1 HI_1476 Uncharacterized HTH-type transcriptional regulator HI_1476 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_12900
Feature type CDS
Gene -
Product Uncharacterized HTH-type transcriptional regulator HI_1476
Location 83078 - 83443 (strand: 1)
Length 366 (nucleotides) / 121 (amino acids)
In genomic island -

Contig

Accession contig_15
Length 114235 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1704
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF00717 Peptidase S24-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2932 Mobilome: prophages, transposons (X) X Phage repressor protein C, contains Cro/C1-type HTH and peptisase s24 domains

Protein Sequence

METIRSIEYTSDEALRLFGHRPSENIKMITVAGDSMQGTINPGDQVFIDVHINYFDGDGVYVFVYGQTLHIKRLQMIKDQLTVISDNNNYRDWQITKEDEDKFFIAGKVLISQSKVYKRYA

Flanking regions ( +/- flanking 50bp)

TTGATGTTGAAGCAAGTGCTGGCCCAGGCATCATAACAAAAGGTGAGTTCATGGAGACGATCAGATCGATTGAATACACCTCCGATGAAGCTTTACGCCTGTTTGGACACCGGCCAAGTGAAAACATAAAAATGATCACTGTTGCCGGTGATAGTATGCAAGGTACAATTAATCCTGGTGACCAAGTTTTTATTGATGTCCACATAAATTACTTTGATGGCGATGGTGTATATGTTTTTGTCTACGGACAAACATTACATATCAAACGGTTACAGATGATTAAAGATCAGCTTACAGTTATTTCCGATAATAATAATTATCGTGACTGGCAAATCACGAAAGAAGACGAAGATAAATTTTTCATTGCCGGAAAAGTGCTGATTAGTCAGTCCAAAGTTTACAAGCGCTACGCCTAAATCCCTATTCAACATTAAACTTTAAATTACAAGGAATTATGCTCCTTGTA