Homologs in group_150

Help

9 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18725 FBDBKF_18725 76.6 Morganella morganii S1 ymfL YmfL family putative regulatory protein
EHELCC_15300 EHELCC_15300 76.6 Morganella morganii S2 ymfL YmfL family putative regulatory protein
EHELCC_19170 EHELCC_19170 76.0 Morganella morganii S2 ymfL YmfL family putative regulatory protein
NLDBIP_15830 NLDBIP_15830 76.6 Morganella morganii S4 ymfL YmfL family putative regulatory protein
NLDBIP_19140 NLDBIP_19140 76.0 Morganella morganii S4 ymfL YmfL family putative regulatory protein
LHKJJB_16010 LHKJJB_16010 76.6 Morganella morganii S3 ymfL YmfL family putative regulatory protein
LHKJJB_19030 LHKJJB_19030 76.0 Morganella morganii S3 ymfL YmfL family putative regulatory protein
HKOGLL_15130 HKOGLL_15130 76.6 Morganella morganii S5 ymfL YmfL family putative regulatory protein
PMI_RS04450 PMI_RS04450 46.7 Proteus mirabilis HI4320 - YmfL family putative regulatory protein

Distribution of the homologs in the orthogroup group_150

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_150

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_12405
Feature type CDS
Gene ymfL
Product YmfL family putative regulatory protein
Location 6043 - 6522 (strand: -1)
Length 480 (nucleotides) / 159 (amino acids)
In genomic island -

Contig

Accession contig_15
Length 114235 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_150
Orthogroup size 10
N. genomes 6

Actions

Genomic region

Domains

PF06892 Phage regulatory protein CII (CP76)

Protein Sequence

MKNESLKEVVKKMCCAMPGGREALAGALGMSLTTFNNNLYEKNGCRFFDNDELEAMEDLTKTRHLVEYHMDRHGITPMEAIEPENIDEVELFKIQTNLSSHQGQLASLIQKSLEDDVLTPEEMTAIYKKMNKVFAYALGFVASLKAVYGVGNDSGNQKG

Flanking regions ( +/- flanking 50bp)

TGGTGTCTATGGATGAGGTAACTACAACCCAATCAGAAAGCGAGTAGGCAATGAAGAATGAATCACTGAAAGAAGTCGTAAAAAAGATGTGCTGCGCCATGCCGGGTGGGCGGGAAGCGCTGGCTGGTGCGCTGGGGATGTCACTGACGACATTCAACAACAATCTGTACGAGAAGAACGGCTGCCGGTTTTTCGACAATGACGAGCTGGAAGCGATGGAAGACCTGACCAAAACCCGTCACCTGGTCGAATACCACATGGACCGGCACGGTATTACACCGATGGAAGCGATAGAACCCGAAAATATCGACGAAGTGGAATTATTCAAAATACAGACAAACCTGAGTTCCCACCAGGGACAACTTGCATCACTTATCCAGAAAAGCCTTGAAGACGATGTGCTGACTCCGGAAGAGATGACAGCGATCTATAAAAAAATGAACAAGGTATTCGCCTATGCGCTGGGTTTTGTCGCATCACTGAAAGCGGTCTACGGGGTGGGAAATGATTCAGGTAACCAGAAAGGGTGAAGCCGAAGGTATACGGCCTCCGGCTTCGGTCGCGCTATATCAATTTGTGT