Homologs in group_1571

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_04980 EHELCC_04980 100.0 Morganella morganii S2 mprA transcriptional repressor MprA
NLDBIP_04980 NLDBIP_04980 100.0 Morganella morganii S4 mprA transcriptional repressor MprA
LHKJJB_13650 LHKJJB_13650 100.0 Morganella morganii S3 mprA transcriptional repressor MprA
HKOGLL_12885 HKOGLL_12885 100.0 Morganella morganii S5 mprA transcriptional repressor MprA
F4V73_RS00160 F4V73_RS00160 95.3 Morganella psychrotolerans mprA transcriptional repressor MprA
PMI_RS02005 PMI_RS02005 82.5 Proteus mirabilis HI4320 mprA transcriptional repressor MprA

Distribution of the homologs in the orthogroup group_1571

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1571

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACR9 1.1e-78 234 68 1 168 2 mprA Transcriptional repressor MprA Escherichia coli (strain K12)
P0ACS0 1.1e-78 234 68 1 168 3 mprA Transcriptional repressor MprA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACS1 1.1e-78 234 68 1 168 3 mprA Transcriptional repressor MprA Escherichia coli O157:H7
P62088 3.78e-31 113 40 0 152 4 prsX HTH-type transcriptional regulator PrsX Escherichia coli
P62089 3.78e-31 113 40 0 152 4 prsX HTH-type transcriptional regulator PrsX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42193 3.47e-29 108 38 0 154 4 papX HTH-type transcriptional regulator PapX Escherichia coli
O34949 1.39e-12 65 32 1 109 4 ykoM Uncharacterized HTH-type transcriptional regulator YkoM Bacillus subtilis (strain 168)
P0A2T4 3.28e-08 53 31 2 141 4 marR Multiple antibiotic resistance protein MarR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T5 3.28e-08 53 31 2 141 3 marR Multiple antibiotic resistance protein MarR Salmonella typhi
O31541 4.45e-07 50 23 0 117 1 yetL HTH-type transcriptional repressor YetL Bacillus subtilis (strain 168)
P42195 2.87e-06 48 28 0 89 4 pecS HTH-type transcriptional regulator PecS Dickeya dadantii (strain 3937)
P97247 4.41e-06 47 24 1 124 4 ysmB Uncharacterized HTH-type transcriptional regulator YsmB Bacillus subtilis (strain 168)
O31564 9.16e-06 47 29 0 79 4 yfiV Uncharacterized HTH-type transcriptional regulator YfiV Bacillus subtilis (strain 168)
P27245 1.69e-05 45 30 3 143 1 marR Multiple antibiotic resistance protein MarR Escherichia coli (strain K12)
O31672 2.13e-05 45 27 1 114 2 mhqR HTH-type transcriptional regulator MhqR Bacillus subtilis (strain 168)
E7GT88 2.49e-05 45 32 3 114 4 bilQ HTH-type transcriptional regulator BilQ Clostridium symbiosum (strain WAL-14163)
Q8CN77 0.000479 42 25 3 133 3 sarZ HTH-type transcriptional regulator SarZ Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLK8 0.000479 42 25 3 133 3 sarZ HTH-type transcriptional regulator SarZ Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1C786 0.000492 42 31 1 90 3 slyA Transcriptional regulator SlyA Yersinia pestis bv. Antiqua (strain Antiqua)
P0DXC9 0.000584 41 25 1 107 4 bilQ HTH-type transcriptional regulator BilQ Clostridioides difficile (strain CD3)
P25150 0.000601 42 28 0 77 4 ywaE Uncharacterized HTH-type transcriptional regulator YwaE Bacillus subtilis (strain 168)
B1JJ73 0.000624 41 31 1 90 1 slyA Transcriptional regulator SlyA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P69989 0.000624 41 31 1 90 2 slyA Transcriptional regulator SlyA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIR6 0.000624 41 31 1 90 3 slyA Transcriptional regulator SlyA Yersinia pestis (strain Pestoides F)
Q1CIM0 0.000624 41 31 1 90 3 slyA Transcriptional regulator SlyA Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZA1 0.000624 41 31 1 90 3 slyA Transcriptional regulator SlyA Yersinia pestis bv. Antiqua (strain Angola)
P69988 0.000624 41 31 1 90 3 slyA Transcriptional regulator SlyA Yersinia pestis
A7FHL4 0.000624 41 31 1 90 3 slyA Transcriptional regulator SlyA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_10180
Feature type CDS
Gene mprA
Product transcriptional repressor MprA
Location 128434 - 128949 (strand: 1)
Length 516 (nucleotides) / 171 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1571
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01047 MarR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1846 Transcription (K) K DNA-binding transcriptional regulator, MarR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15974 MarR family transcriptional regulator, negative regulator of the multidrug operon emrRAB - -

Protein Sequence

MESSFTPTEELLNSRISQQKNLGADLPYQEILLTRLSMHVQSKLLEKRNNMLKSQGINETLFMALMILDTKESHSIQPSELSAALGSSRTNATRIADELEKNGWIERKESHNDRRCLHLHLTEKGSDFLHSLLPPQHDALRHIWSALAEDEQKNLEKLMRKLLIQLDKSDN

Flanking regions ( +/- flanking 50bp)

GGTCATAGCCGGGTTAACATACCAACAGAAACTAATAAGGTATCTCAATAATGGAAAGTTCATTTACACCGACAGAAGAATTGCTTAACAGCCGGATCTCACAACAGAAGAATCTGGGTGCCGATCTGCCGTATCAGGAAATTTTACTGACCCGGCTTTCAATGCACGTTCAGAGTAAATTATTAGAAAAACGCAACAATATGCTGAAATCTCAGGGCATCAATGAGACGTTATTCATGGCACTGATGATTCTGGATACTAAAGAATCTCACAGCATTCAGCCTTCAGAACTCAGCGCCGCACTCGGCTCTTCCCGCACCAATGCGACCCGCATTGCGGATGAACTCGAGAAAAACGGCTGGATTGAGCGCAAAGAGAGCCACAATGACCGCCGCTGTCTGCATCTGCACCTGACAGAGAAAGGCTCAGATTTTCTGCACAGTCTGCTGCCGCCTCAGCATGATGCATTGCGTCATATCTGGTCAGCACTGGCTGAAGATGAACAGAAAAACCTGGAAAAGCTGATGCGCAAACTGCTTATTCAGCTTGATAAGAGCGACAACTAAATAACCTTTTATTGTTTAAGGTTAATGAATAAGAGCTTTTCTCAATAAGC