Homologs in group_316

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_10100 EHELCC_10100 100.0 Morganella morganii S2 escR EscR/YscR/HrcR family type III secretion system export apparatus protein
NLDBIP_10445 NLDBIP_10445 100.0 Morganella morganii S4 escR EscR/YscR/HrcR family type III secretion system export apparatus protein
LHKJJB_10910 LHKJJB_10910 100.0 Morganella morganii S3 escR EscR/YscR/HrcR family type III secretion system export apparatus protein
HKOGLL_13970 HKOGLL_13970 100.0 Morganella morganii S5 escR EscR/YscR/HrcR family type III secretion system export apparatus protein
F4V73_RS08335 F4V73_RS08335 36.5 Morganella psychrotolerans sctR type III secretion system export apparatus subunit SctR
F4V73_RS10655 F4V73_RS10655 85.4 Morganella psychrotolerans - EscR/YscR/HrcR family type III secretion system export apparatus protein
PMI_RS13245 PMI_RS13245 61.0 Proteus mirabilis HI4320 - EscR/YscR/HrcR family type III secretion system export apparatus protein

Distribution of the homologs in the orthogroup group_316

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_316

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1L4 3.36e-78 236 53 1 213 3 spaP Surface presentation of antigens protein SpaP Shigella sonnei
P0A1L3 3.36e-78 236 53 1 213 1 spaP Surface presentation of antigens protein SpaP Shigella flexneri
Q56023 2.11e-74 227 56 2 218 3 spaP Surface presentation of antigens protein SpaP Salmonella typhi
P40700 2.18e-74 227 56 2 218 1 spaP Surface presentation of antigens protein SpaP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P69981 2.98e-47 157 45 2 191 3 yscR Yop proteins translocation protein R Yersinia pseudotuberculosis serotype I (strain IP32953)
P69980 2.98e-47 157 45 2 191 3 yscR Yop proteins translocation protein R Yersinia pestis
Q46646 1.22e-40 140 37 2 206 3 hrcR Harpin secretion protein HrcR Erwinia amylovora
Q52488 5.71e-37 131 36 1 209 3 hrcR Hypersensitivity response secretion protein HrcR Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P55720 1.3e-36 130 39 2 190 3 NGR_a00610 Probable translocation protein y4yL Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P74890 2.61e-36 129 33 5 223 2 yscR Virulence protein YscR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P54700 4.8e-35 127 37 4 212 1 fliP Flagellar biosynthetic protein FliP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AC05 8.47e-35 127 36 4 211 3 fliP Flagellar biosynthetic protein FliP Escherichia coli (strain K12)
P0AC06 8.47e-35 127 36 4 211 3 fliP Flagellar biosynthetic protein FliP Escherichia coli O157:H7
P37828 2.63e-34 124 34 2 216 3 None Pathogenicity-related ORF2 Xanthomonas campestris pv. glycines
Q47856 3.24e-34 124 36 0 196 3 hrcR Harpin secretion protein HrcR Pantoea agglomerans pv. gypsophilae
Q9X5A6 1.52e-33 124 35 5 222 3 fliP Flagellar biosynthetic protein FliP Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q60236 9.85e-33 120 38 2 206 3 hrpW Harpin secretion protein HrpW Pseudomonas syringae pv. syringae
P35528 6.79e-32 118 33 5 216 3 fliP Flagellar biosynthetic protein FliP Bacillus subtilis (strain 168)
P34200 5.4e-31 117 35 4 211 3 fliP Flagellar biosynthetic protein FliP Pectobacterium carotovorum subsp. carotovorum
O85133 6.41e-31 118 36 5 222 3 fliP Flagellar biosynthetic protein FliP Cereibacter sphaeroides
Q51468 3.64e-30 115 35 7 223 3 fliP Flagellar biosynthetic protein FliP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P74930 4.81e-30 115 34 4 206 3 fliP Flagellar biosynthetic protein FliP Treponema pallidum (strain Nichols)
Q45980 9.87e-30 114 32 4 227 3 fliP Flagellar biosynthetic protein FliP Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P57184 3.87e-29 115 34 3 210 3 fliP Flagellar biosynthetic protein FliP Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q44763 1.39e-27 108 31 5 202 3 fliP Flagellar biosynthetic protein FliP Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O67750 1.61e-27 107 29 6 216 3 fliP Flagellar biosynthetic protein FliP Aquifex aeolicus (strain VF5)
P37827 3.43e-27 107 29 5 208 3 fliP Flagellar biosynthetic protein FliP Rhizobium meliloti (strain 1021)
Q89AZ2 3.81e-27 109 32 4 211 3 fliP Flagellar biosynthetic protein FliP Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8KA37 1.4e-26 108 33 4 216 3 fliP Flagellar biosynthetic protein FliP Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q44344 4.63e-26 103 30 5 207 3 fliP Flagellar biosynthetic protein FliP Agrobacterium fabrum (strain C58 / ATCC 33970)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09310
Feature type CDS
Gene escR
Product EscR/YscR/HrcR family type III secretion system export apparatus protein
Location 93768 - 94427 (strand: -1)
Length 660 (nucleotides) / 219 (amino acids)

Contig

Accession contig_10
Length 146103 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_316
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00813 FliP family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4790 Intracellular trafficking, secretion, and vesicular transport (U) U Type III secretory pathway, EscR/YscR component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22507 type III secretion system export apparatus protein - -

Protein Sequence

MTDSAVSMMLMLAAASVLPFILAAGTCYLKFSIVFVMVRNALGVQQVPSNMVLNAIAFILAMVVMFPLVSKTYAYVNENPVELSQPESLSRFTDEGLQDYRDYLFRYADKPLLYFFAQTDVDEDAEPELSDARDIAFFPLLAAYALGEIKSAFLISFYLYLPFIVIDLVVSSVLLALGMMMMSPVTLSVPIKLILFIALDGWSLLSTSLVSQYLELMDI

Flanking regions ( +/- flanking 50bp)

GGGGAACAATACGCCGTGGAAATTCATCATATCTTTCATAAGGGTGAATGATGACTGACAGCGCTGTTTCGATGATGCTGATGCTGGCCGCAGCATCTGTTCTGCCCTTTATTCTGGCGGCCGGAACCTGCTACCTCAAATTTTCCATTGTTTTTGTGATGGTGCGCAACGCCCTGGGGGTTCAGCAGGTGCCGTCAAATATGGTACTCAATGCGATTGCGTTTATTCTGGCGATGGTGGTGATGTTTCCGCTGGTCAGTAAAACCTATGCGTATGTTAATGAAAATCCGGTGGAATTATCTCAGCCGGAATCACTGTCGCGTTTTACGGATGAGGGGTTACAGGATTACCGGGACTATCTCTTCCGTTATGCCGATAAACCTCTGCTGTATTTTTTTGCGCAAACAGACGTTGATGAGGATGCTGAACCGGAACTGAGTGATGCCCGTGATATCGCATTCTTTCCCCTGCTGGCCGCCTATGCGCTGGGGGAAATCAAATCTGCTTTTCTGATCAGCTTCTATCTCTATCTGCCGTTTATCGTGATTGATCTCGTGGTGTCCAGCGTTTTGCTGGCGCTGGGGATGATGATGATGAGCCCGGTCACACTCTCGGTACCGATCAAACTGATCTTATTTATTGCCCTTGATGGCTGGTCGCTGTTATCCACCAGTCTGGTGTCTCAGTATCTCGAACTTATGGACATATAACATGGATGTGATTTATGCAGCGGATAAAGGAATTTATCTGGTGATTATGT