Homologs in group_1390

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12935 EHELCC_12935 100.0 Morganella morganii S2 ispB octaprenyl diphosphate synthase
NLDBIP_13275 NLDBIP_13275 100.0 Morganella morganii S4 ispB octaprenyl diphosphate synthase
LHKJJB_13280 LHKJJB_13280 100.0 Morganella morganii S3 ispB octaprenyl diphosphate synthase
HKOGLL_11750 HKOGLL_11750 100.0 Morganella morganii S5 ispB octaprenyl diphosphate synthase
F4V73_RS09815 F4V73_RS09815 94.7 Morganella psychrotolerans ispB octaprenyl diphosphate synthase
PMI_RS16945 PMI_RS16945 84.5 Proteus mirabilis HI4320 ispB octaprenyl diphosphate synthase

Distribution of the homologs in the orthogroup group_1390

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1390

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AD58 0.0 506 75 0 321 3 ispB Octaprenyl diphosphate synthase Shigella flexneri
P0AD57 0.0 506 75 0 321 1 ispB Octaprenyl diphosphate synthase Escherichia coli (strain K12)
P44916 9.45e-152 431 64 0 322 1 ispB Octaprenyl diphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O24743 3.36e-99 298 48 3 319 1 sdsA All-trans-nonaprenyl-diphosphate synthase (geranyl-diphosphate specific) Rhodobacter capsulatus
Q0INZ4 3.06e-54 185 32 3 322 3 SPS3 Probable solanesyl-diphosphate synthase 3, chloroplastic Oryza sativa subsp. japonica
Q76FS5 7.51e-54 184 32 2 324 1 SPS2 Solanesyl diphosphate synthase 2, chloroplastic Arabidopsis thaliana
Q75HZ9 6.92e-53 181 31 3 323 1 SPS2 Solanesyl-diphosphate synthase 2, chloroplastic Oryza sativa subsp. japonica
Q8S948 3.92e-52 179 32 2 312 1 SPS1 Solanesyl diphosphate synthase 1, chloroplastic Arabidopsis thaliana
P31114 2.61e-51 176 30 1 311 1 hepT Heptaprenyl diphosphate synthase component 2 Bacillus subtilis (strain 168)
P72580 5.75e-51 174 32 2 324 3 preA Prenyl transferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P55785 4.13e-50 172 30 1 315 3 hepT Heptaprenyl diphosphate synthase component 2 Geobacillus stearothermophilus
Q9TLS1 5.57e-48 166 30 3 315 3 preA Prenyl transferase Cyanidium caldarium
Q653T6 1.5e-47 168 33 4 323 1 SPS1 Solanesyl-diphosphate synthase 1, mitochondrial Oryza sativa subsp. japonica
Q53479 2.08e-47 165 35 3 288 1 idsA Short chain isoprenyl diphosphate synthase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O26156 1.34e-46 163 34 3 288 3 idsA Short chain isoprenyl diphosphate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P39464 3.15e-46 162 30 5 319 1 gds Geranylgeranyl diphosphate synthase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
O43091 1.52e-45 161 31 7 345 1 dps1 Decaprenyl-diphosphate synthase subunit 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1XDL8 1.72e-45 160 32 2 287 3 preA Prenyl transferase Neopyropia yezoensis
P31171 3.11e-45 159 32 3 319 3 preA Prenyl transferase Cyanophora paradoxa
A0A0A7GEY4 8.59e-45 158 31 6 325 1 GACE_1337 Geranylgeranyl pyrophosphate synthase Geoglobus acetivorans
P51268 1.19e-44 158 31 2 287 3 preA Prenyl transferase Porphyra purpurea
P95999 5.56e-43 154 28 3 314 3 gds Geranylgeranyl diphosphate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q7S565 6.06e-43 156 31 5 369 3 NCU02305 Probable hexaprenyl pyrophosphate synthase, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q54VJ9 5.82e-42 154 30 4 334 3 coq1 Decaprenyl-diphosphate synthase Dictyostelium discoideum
O66129 8.27e-42 150 29 3 309 1 hexs-b Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) Micrococcus luteus
Q5HZ00 1.13e-41 152 31 7 343 1 SPS3 Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial Arabidopsis thaliana
Q5T2R2 1.38e-41 152 30 4 320 1 PDSS1 All trans-polyprenyl-diphosphate synthase PDSS1 Homo sapiens
Q58270 5.59e-40 145 35 4 234 3 idsA Short chain isoprenyl diphosphate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8PW34 7.26e-39 142 33 5 292 3 MM_1767 Geranylgeranyl diphosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q33DR2 1.9e-38 144 30 4 320 1 Pdss1 All trans-polyprenyl-diphosphate synthase PDSS1 Mus musculus
P18900 1.4e-37 142 33 6 303 1 COQ1 Hexaprenyl pyrophosphate synthase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6CBH3 1.11e-36 139 34 4 264 3 COQ1 Probable hexaprenyl pyrophosphate synthase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
Q08291 1.24e-34 130 35 5 225 1 None Farnesyl diphosphate synthase Geobacillus stearothermophilus
B1XJV9 1.4e-34 130 32 7 256 1 crtE Geranylgeranyl pyrophosphate synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q9UWR6 5.28e-34 129 33 5 296 1 fgs Geranylfarnesyl diphosphate synthase Aeropyrum pernix
Q94ID7 2.87e-31 123 32 6 261 1 GGPS Geranylgeranyl pyrophosphate synthase, chloroplastic Hevea brasiliensis
Q9ZU77 1.33e-30 121 31 6 263 2 At2g18620 Geranylgeranyl pyrophosphate synthase 7, chloroplastic Arabidopsis thaliana
Q9LRR0 6.77e-30 119 33 5 240 5 At3g14510 Putative geranylgeranyl pyrophosphate synthase 8, chloroplastic Arabidopsis thaliana
Q42698 1.41e-29 119 33 6 235 3 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic Catharanthus roseus
Q3IPL1 2.26e-29 118 29 5 328 1 idsA3 Geranylfarnesyl diphosphate synthase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q8PYS1 2.93e-29 116 31 3 201 1 MM_0789 Geranylfarnesyl diphosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P34802 4.04e-29 117 29 6 263 1 GGPPS1 Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic Arabidopsis thaliana
O06428 6.41e-29 116 32 7 306 1 grcC1 Nonaprenyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O05572 7.21e-29 116 29 10 328 1 grcC2 Dimethylallyltranstransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9SLG2 1.2e-28 116 29 6 269 1 GGPP4 Geranylgeranyl pyrophosphate synthase 4 Arabidopsis thaliana
P9WKH1 2.07e-28 115 28 3 272 1 Rv3398c (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKH0 2.07e-28 115 28 3 272 3 MT3506 (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5H9 2.07e-28 115 28 3 272 3 BQ2027_MB3431C (2E,6E)-farnesyl diphosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P80042 8.37e-28 114 28 3 251 1 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic Capsicum annuum
A0A0U3BRC5 1.33e-27 113 31 6 266 1 GFDPS Geranylfarnesyl diphosphate synthase, chloroplastic Leucosceptrum canum
O50410 1.71e-26 110 29 5 284 1 idsB Geranylgeranyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q43133 3.13e-26 110 28 6 245 1 GGPS1 Geranylgeranyl pyrophosphate synthase, chloroplastic/chromoplastic Sinapis alba
P48368 6.49e-26 107 29 3 235 3 crtE Geranylgeranyl diphosphate synthase Cyanophora paradoxa
O04046 1.11e-25 108 28 6 240 1 GGPPS2 Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 2 Arabidopsis thaliana
Q9LUD9 1.99e-25 107 33 5 238 1 GGPP3 Geranylgeranyl pyrophosphate synthase 3, chloroplastic Arabidopsis thaliana
Q9LHR4 7.82e-25 105 32 6 262 2 At3g32040 Geranylgeranyl pyrophosphate synthase 12, chloroplastic Arabidopsis thaliana
P54383 7.93e-25 104 31 4 233 3 ispA Farnesyl diphosphate synthase Bacillus subtilis (strain 168)
Q9LIA0 1.11e-24 105 32 7 261 2 At3g29430 Geranylgeranyl pyrophosphate synthase 11, chloroplastic Arabidopsis thaliana
O66126 1.15e-24 104 29 5 243 3 fps Farnesyl diphosphate synthase Micrococcus luteus
Q9LUE1 1.73e-24 105 32 5 238 1 GGPPS9 Geranylgeranyl pyrophosphate synthase 9, chloroplastic Arabidopsis thaliana
O22043 6.99e-24 103 32 6 249 1 GGPP6 Geranylgeranyl pyrophosphate synthase 6, mitochondrial Arabidopsis thaliana
V5TF61 7.02e-24 103 30 5 239 1 ambP2 Dimethylallyltranstransferase Fischerella ambigua (strain UTEX 1903)
Q9LJY2 3.14e-23 101 30 5 221 1 At3g20160 Geranylgeranyl pyrophosphate synthase 10, mitochondrial Arabidopsis thaliana
O66952 3.31e-23 99 31 7 233 3 ispA Farnesyl diphosphate synthase Aquifex aeolicus (strain VF5)
P21684 2.65e-22 98 33 7 207 3 crtE Geranylgeranyl diphosphate synthase Pantoea ananas
P17060 2.9e-22 97 33 7 212 3 crtE Geranylgeranyl diphosphate synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A0A1B4XBK0 5.97e-20 93 29 7 267 3 sdnC Geranylgeranyl diphosphate synthase sdnC Sordaria araneosa
P9WEW8 1.01e-19 91 26 5 262 1 dpmpD Geranylgeranyl pyrophosphate synthase dpmpD Macrophomina phaseolina (strain MS6)
P22939 1.28e-19 90 32 7 248 1 ispA Farnesyl diphosphate synthase Escherichia coli (strain K12)
F9WWF1 2.61e-19 90 26 7 226 3 GGS2 Geranylgeranyl pyrophosphate synthase 2 Zymoseptoria tritici (strain CBS 115943 / IPO323)
Q6F5E6 2.93e-19 90 24 4 252 1 GGS Geranylgeranyl pyrophosphate synthase Neocamarosporium betae
A0A1Y1C7Q5 4.28e-19 91 26 4 269 3 EvQS Quiannulatene synthase Emericella variicolor
P22873 6.79e-19 88 32 8 206 1 crtE Geranylgeranyl diphosphate synthase Pseudescherichia vulneris
P9WEQ2 9.47e-19 88 23 4 298 3 olcC Geranylgeranyl pyrophosphate synthase olcC Penicillium canescens
Q92236 1.08e-18 89 26 4 249 3 GGS Geranylgeranyl pyrophosphate synthase Gibberella fujikuroi
P45204 1.22e-18 87 28 7 263 3 ispA Farnesyl diphosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C9K2Q3 2.57e-18 89 31 2 210 1 bsc8 Fusicoccadiene synthase Alternaria brassicicola
F9WZD2 2.57e-18 87 26 4 257 3 GGS1 Geranylgeranyl pyrophosphate synthase 1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
P54976 3.35e-18 86 30 7 211 3 crtE Geranylgeranyl diphosphate synthase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A0A0E3D8P4 3.44e-18 87 26 7 272 3 penG Geranylgeranyl pyrophosphate synthase penG Penicillium crustosum
A0A0E3D8M9 4.78e-18 87 25 6 271 3 janG Geranylgeranyl pyrophosphate synthase janG Penicillium janthinellum
K2SUY0 7.07e-18 87 29 7 224 1 MPH_02178 Macrophomene synthase Macrophomina phaseolina (strain MS6)
A0A140JWS2 8.84e-18 86 25 5 271 3 ptmG Geranylgeranyl pyrophosphate synthase penG Penicillium simplicissimum
Q758K0 1.95e-17 84 27 7 281 3 BTS1 Geranylgeranyl pyrophosphate synthase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
I1RL14 2.14e-17 85 26 4 224 1 dpfgD Geranylgeranyl pyrophosphate synthase dpfgD Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q39108 2.65e-17 84 25 6 215 1 GGR Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic Arabidopsis thaliana
P9WEX3 9.33e-17 83 25 4 236 1 dpasD Geranylgeranyl pyrophosphate synthase dpasD Apiospora sacchari
Q54BK1 9.35e-17 82 26 9 286 3 ggps1 Geranylgeranyl pyrophosphate synthase Dictyostelium discoideum
P9WER5 1.65e-16 83 27 8 276 1 None Talaropentaene synthase Talaromyces verruculosus
N4V6D4 2.57e-16 83 25 5 233 1 btcA Sesterterpene synthase btcA Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)
P55539 3.48e-16 81 33 8 218 3 NGR_a02750 Probable farnesyl diphosphate synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9P885 3.63e-16 80 24 6 274 1 carG Geranylgeranyl pyrophosphate synthase Mucor circinelloides f. lusitanicus
Q12051 4.09e-16 81 24 5 224 1 BTS1 Geranylgeranyl pyrophosphate synthase BTS1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A2Z6AQX6 5.05e-16 82 26 7 236 1 PvPS Preasperterpenoid A synthase PvPS Talaromyces verruculosus
A0A0P0ZD79 6.05e-16 82 26 6 243 1 EvVS Variediene synthase Emericella variicolor
Q672V6 6.41e-16 80 25 7 276 2 atmG Geranylgeranyl pyrophosphate synthase atmG Aspergillus flavus
A0A1U8QLG8 6.92e-16 81 25 5 278 2 AN1592 Geranylgeranyl pyrophosphate synthase AN1592 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0P0ZEM1 7.31e-16 81 27 6 224 1 Stl-SS Stellatatriene synthase Emericella variicolor
O53507 7.58e-16 80 27 9 324 1 idsA2 (2E,6E)-farnesyl diphosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A348FUE1 7.73e-16 82 24 5 272 1 PvCPS Copalyl diphosphate synthase Talaromyces verruculosus
A0A1V1FVQ6 9.46e-16 81 26 6 248 1 oblA Ophiobolin F synthase oblA Emericella variicolor
A0A1L9UKS1 1.5e-15 80 28 6 222 1 AbVS Variediene synthase Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
F9XLC1 2.07e-15 79 27 4 211 3 GGS3 Geranylgeranyl pyrophosphate synthase 3 Zymoseptoria tritici (strain CBS 115943 / IPO323)
H1VQB1 2.15e-15 79 24 4 224 1 dpchD Geranylgeranyl pyrophosphate synthase dpchD Colletotrichum higginsianum (strain IMI 349063)
M2V8C1 2.5e-15 80 26 6 276 1 oblA Ophiobolin F synthase oblA Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)
A0A1L9WQI2 2.63e-15 80 27 6 224 1 vrcA Bifunctional sesterterpene synthase Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A0U5G0B1 2.78e-15 80 25 7 253 1 AcldOS Ophiobolin F synthase Aspergillus calidoustus
A0A858E7G0 2.97e-15 79 26 10 297 1 GGDPS Geranylgeranyl pyrophosphate synthase Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
J7FIX8 4.43e-15 78 26 5 216 3 idtG Geranylgeranyl pyrophosphate synthase idtG Claviceps paspali
B2DBE9 4.71e-15 79 23 7 259 1 GGS-D Geranylgeranyl pyrophosphate synthase D Phomopsis amygdali
P9WEX9 5.98e-15 77 23 4 227 1 dpmaD Geranylgeranyl pyrophosphate synthase dpmaD Metarhizium anisopliae
Q9WTN0 6.82e-15 77 25 6 271 1 Ggps1 Geranylgeranyl pyrophosphate synthase Mus musculus
A2PZA5 8.36e-15 78 27 4 221 1 PaFS Fusicoccadiene synthase Phomopsis amygdali
O95749 1.07e-14 76 24 6 273 1 GGPS1 Geranylgeranyl pyrophosphate synthase Homo sapiens
Q6F596 1.23e-14 76 24 5 273 2 Ggps1 Geranylgeranyl pyrophosphate synthase Rattus norvegicus
P24322 1.46e-14 77 24 4 263 2 al-3 Geranylgeranyl pyrophosphate synthase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
S0E627 1.5e-14 77 25 5 280 2 GGS2 Geranylgeranyl pyrophosphate synthase 2 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P56966 1.58e-14 76 25 7 273 1 GGPS1 Geranylgeranyl pyrophosphate synthase Bos taurus
Q45220 3.08e-14 75 33 9 218 3 fppS Probable farnesyl diphosphate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
W6QAE7 4.68e-14 76 27 4 184 1 PrDS Conidiogenone synthase Penicillium roqueforti (strain FM164)
Q56RZ7 5.04e-14 75 24 7 278 2 ltmG Geranylgeranyl pyrophosphate synthase ltmG Epichloe festucae var. lolii
Q56RZ3 5.04e-14 75 24 7 278 2 ltmG Geranylgeranyl pyrophosphate synthase ltmG Epichloe festucae (strain Fl1)
E9F5E9 6.35e-14 74 23 4 229 1 subD Geranylgeranyl pyrophosphate synthase subD Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A7D0AGU9 8.9e-14 73 23 5 272 2 TPS Terpene synthase Matsumurasca onukii
P9WEP0 1e-13 75 26 4 215 1 AuAS Aspergildiene synthase Aspergillus ustus
B6HFX8 1.15e-13 75 28 6 194 1 PchDS Conidiogenone synthase Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A858E6N7 2.51e-13 73 25 8 236 1 GGDPS Geranylgeranyl pyrophosphate synthase Melampsora lini
B2DBE8 3.15e-13 73 26 3 215 1 GGS-A Geranylgeranyl pyrophosphate synthase A Phomopsis amygdali
A0A8K1AY78 3.49e-13 73 25 7 227 1 tndC Bifunctional type I diterpene synthase tndC Aspergillus flavipes
A0A8D5M3Y5 5.18e-13 72 26 5 223 1 esdpD Geranylgeranyl pyrophosphate synthase esdpD Penicillium shearii
P9WEV7 6.86e-13 72 30 4 179 1 CgDS Dolasta-1(15),8-diene synthase Colletotrichum gloeosporioides
Q9C446 8.64e-13 71 24 4 252 3 paxG Geranylgeranyl pyrophosphate synthase paxG Penicillium paxilli
A0A2Z6FZ31 9.96e-13 72 25 4 183 1 btcA Sesterterpene synthase btcA Neocamarosporium betae
P57537 1.4e-12 70 25 10 270 3 ispA Farnesyl diphosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0A2Z6AQX7 1.52e-12 71 26 5 216 1 PbSS Sesterbrasiliatriene synthase PbSS Penicillium brasilianum
P9WER6 1.93e-12 71 26 7 223 1 None Fusoxypene synthase Fusarium oxysporum
A0A1L7VFX3 2.97e-12 70 29 6 183 1 FUP1 Bifunctional terpene synthase FUP1 Fusarium proliferatum (strain ET1)
A1C8C3 4.12e-12 70 23 6 252 1 oblA Ophiobolin F synthase oblA Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
P9WEV6 5.45e-12 70 27 7 294 1 PaPS Phomopsene synthase Phomopsis amygdali
A0A2I6PJ05 1.02e-11 68 23 5 252 3 ggs1 Geranylgeranyl pyrophosphate synthase Hypoxylon pulicicidum
M2U578 1.03e-11 69 27 4 182 1 tpcA Preterpestacin I synthase tpcA Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O)
A0A3Q9FFM1 1.71e-11 68 25 6 220 1 astC Bifunctional sesterterpene synthase astC Talaromyces wortmannii
A0A169T193 1.73e-11 68 23 4 253 1 EvAS Astellifadiene synthase Emericella variicolor
A0A2L0VXR5 2.57e-11 67 26 5 268 2 GGPS Geranylgeranyl pyrophosphate synthase Clitopilus passeckerianus
Q8K9A0 2.67e-11 66 26 10 262 3 ispA Farnesyl diphosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q97W92 8.35e-11 65 28 6 216 1 gdS-2 Hexaprenyl pyrophosphate synthase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A0A858E7J4 8.99e-11 65 26 7 184 1 ILTPS1 IDS-like terpene synthase 1 Melampsora lini
A0A3S5XFG0 3.39e-10 63 23 6 268 1 cle6 Geranylgeranyl pyrophosphate synthase cle6 Aspergillus versicolor
P9WEV2 3.98e-10 64 22 3 223 1 sttA Preaspterpenacid I synthase sttA Aspergillus terreus
A0A6S6QJ62 6.2e-10 63 25 5 268 1 ple4 Geranylgeranyl pyrophosphate synthase Rhodocybe pseudopiperita
A1DN30 8.44e-10 63 23 3 215 1 NfSS Sesterfisherol synthase Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
A0A8H4CUY8 1.04e-09 63 23 5 228 1 GCG54_00000376 Colleterpenol synthase Colletotrichum gloeosporioides
A0A348DU52 1.25e-09 62 27 9 213 1 PcCS Cyclopiane-type diterpene synthase Penicillium chrysogenum
A0A1V0QSA8 8.08e-09 59 21 7 250 2 eriE Geranylgeranyl pyrophosphate synthase AN1592 Hericium erinaceus
A0A858E4Y6 9.67e-09 59 24 6 181 1 ILTPS2 IDS-like terpene synthase 2 Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
Q0CRW6 1.65e-08 59 22 5 228 1 sttA Preaspterpenacid I synthase sttA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A858E899 1.79e-08 58 26 7 190 1 ILTPS3 IDS-like terpene synthase 3 Melampsora lini
D7PHZ5 5.69e-08 57 26 6 206 1 vrtD Farnesyl pyrophosphate synthase vrtD Penicillium aethiopicum
A0A858E4Y8 9.37e-08 56 22 6 189 1 ILTPS1 IDS-like terpene synthase 1 Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7)
A0A858EAD5 3.51e-07 54 23 7 193 1 ILTPS2 IDS-like terpene synthase 2 Melampsora lini
A0A0E3D8N1 1.79e-06 52 23 4 259 3 penC Prenyl transferase penC Penicillium crustosum
Q5U2R1 2.8e-06 52 21 10 342 2 Pdss2 All trans-polyprenyl-diphosphate synthase PDSS2 Rattus norvegicus
A0A2I6PJ13 3.15e-06 51 24 9 257 3 nodC Prenyl transferase nodC Hypoxylon pulicicidum
Q33DR3 4.67e-06 51 23 8 264 1 Pdss2 All trans-polyprenyl-diphosphate synthase PDSS2 Mus musculus
P0C9E2 5.08e-06 51 27 7 195 3 Ken-086 Trans-prenyltransferase African swine fever virus (isolate Pig/Kenya/KEN-50/1950)
Q4WEB8 1.54e-05 49 25 9 285 3 erg20 Farnesyl pyrophosphate synthase erg20 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q8V9T7 1.62e-05 49 26 6 190 3 Mal-082 Trans-prenyltransferase African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983)
P0C9E0 1.96e-05 49 27 6 188 3 Pret-086 Trans-prenyltransferase African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996)
A0A140JWT3 2.14e-05 49 23 6 262 3 ptmC Prenyl transferase ptmC Penicillium simplicissimum
Q65164 3.16e-05 48 27 6 188 1 Ba71V-074 Trans-prenyltransferase African swine fever virus (strain Badajoz 1971 Vero-adapted)
Q86YH6 5.21e-05 48 19 8 337 1 PDSS2 All trans-polyprenyl-diphosphate synthase PDSS2 Homo sapiens
Q9NH03 5.24e-05 48 26 9 209 2 fps Farnesyl diphosphate synthase Dictyostelium discoideum
P0C9E1 5.47e-05 47 26 6 188 3 War-084 Trans-prenyltransferase African swine fever virus (isolate Warthog/Namibia/Wart80/1980)
B4YA15 8.74e-05 47 25 8 221 2 FPS Farnesyl pyrophosphate synthase Ganoderma lucidum
Q92250 0.000112 47 26 9 249 3 fpp Farnesyl pyrophosphate synthase Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q920E5 0.000131 47 24 7 222 1 Fdps Farnesyl pyrophosphate synthase Mus musculus
O14230 0.000143 46 26 5 180 1 fps1 Farnesyl pyrophosphate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A7J6HWR9 0.000187 46 25 7 200 2 FPPS1 Farnesyl pyrophosphate synthase 1 Cannabis sativa
Q09152 0.00029 45 24 5 202 2 FPS1 Farnesyl pyrophosphate synthase 1, mitochondrial Arabidopsis thaliana
Q672V5 0.000541 45 23 6 207 2 atmC Prenyl transferase atmC Aspergillus flavus
O24241 0.000708 44 23 8 209 2 FPS1 Farnesyl pyrophosphate synthase 1 Parthenium argentatum
Q4JHN6 0.00074 44 23 6 202 2 FPS Farnesyl pyrophosphate synthase Panax ginseng

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_08590
Feature type CDS
Gene ispB
Product octaprenyl diphosphate synthase
Location 100328 - 101299 (strand: -1)
Length 972 (nucleotides) / 323 (amino acids)

Contig

Accession contig_9
Length 163724 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1390
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00348 Polyprenyl synthetase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0142 Coenzyme transport and metabolism (H) H Geranylgeranyl pyrophosphate synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02523 octaprenyl-diphosphate synthase [EC:2.5.1.90] Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites		 -

Protein Sequence

MNSEQIIALTADDMTAVNQKIQKQLTSDVSLINQLGYYIISGGGKRIRPMIAVLTGRALGYDGDKHIQVAALIEFIHTATLLHDDVVDESDMRRGKQTANEVFGNAASVLVGDFIYTRSFQMMTDLDSMRVLKLMSEATNVIAEGEVLQLMNCNDPDISEADYMQVIYSKTARLFEAASQSAAILAGATPEQEKALQDYGRFLGTAFQLIDDVLDYDADNATLGKNTGDDLDEGKPTLPLLHAMHNGNAEESALIRQAIEQGNGRHLLEQVLATMKRCGSLAYTYARAEEEADKAIAALSALPDSQYKDALAGLAHIAVRRSA

Flanking regions ( +/- flanking 50bp)

AAACCATTACCTTTGATCGGGATGTCAAAAACAAGGTTAAAGCAAGTCATATGAACTCAGAACAAATAATCGCGCTGACTGCGGATGATATGACCGCAGTCAATCAAAAGATTCAAAAACAGCTGACCTCGGACGTATCGCTTATCAACCAGCTGGGTTACTACATTATCAGCGGCGGCGGGAAACGGATCCGCCCGATGATCGCTGTGCTGACCGGCCGGGCTCTGGGCTATGATGGCGACAAACATATTCAGGTGGCGGCTCTGATCGAATTTATTCATACCGCCACCCTGCTGCACGACGATGTGGTGGATGAATCCGACATGCGCCGCGGCAAACAGACAGCCAACGAAGTGTTCGGCAATGCCGCCAGTGTGCTGGTCGGGGATTTTATCTACACACGATCCTTTCAGATGATGACGGATCTGGATTCCATGCGTGTGCTGAAACTGATGTCAGAAGCGACAAACGTGATCGCGGAAGGAGAAGTGCTGCAACTGATGAACTGCAACGATCCGGATATCAGCGAAGCGGATTACATGCAGGTTATCTACAGCAAAACTGCCCGCCTGTTTGAGGCTGCCTCACAATCTGCGGCAATTCTGGCCGGTGCCACACCGGAACAGGAAAAGGCCCTTCAGGATTACGGCCGCTTTCTCGGTACCGCGTTTCAGCTGATCGATGATGTTCTGGATTATGATGCGGATAACGCGACACTCGGCAAAAATACCGGGGATGATCTCGACGAAGGCAAACCGACGCTCCCGCTGCTCCACGCCATGCACAACGGTAATGCGGAAGAATCCGCGCTGATCCGTCAGGCGATTGAACAGGGTAACGGACGTCACCTGCTGGAGCAGGTTCTTGCAACCATGAAGCGCTGCGGATCTCTGGCTTACACCTATGCCCGCGCCGAAGAAGAAGCGGACAAAGCTATCGCAGCCCTGTCCGCACTGCCGGACTCACAGTACAAAGATGCACTGGCCGGCCTGGCCCATATCGCAGTCCGCCGCTCAGCCTGATCATTGCATGAGAAAACGGGATCTTCACAGATCCCGTTTTTTTATTCCGG