Homologs in group_1269

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17170 EHELCC_17170 100.0 Morganella morganii S2 nirD nitrite reductase small subunit NirD
NLDBIP_13775 NLDBIP_13775 100.0 Morganella morganii S4 nirD nitrite reductase small subunit NirD
LHKJJB_09075 LHKJJB_09075 100.0 Morganella morganii S3 nirD nitrite reductase small subunit NirD
HKOGLL_08625 HKOGLL_08625 100.0 Morganella morganii S5 nirD nitrite reductase small subunit NirD
F4V73_RS13610 F4V73_RS13610 78.4 Morganella psychrotolerans nirD nitrite reductase small subunit NirD
PMI_RS07155 PMI_RS07155 71.8 Proteus mirabilis HI4320 nirD nitrite reductase small subunit NirD

Distribution of the homologs in the orthogroup group_1269

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1269

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A229 2.51e-50 157 63 0 108 4 nirD Nitrite reductase (NADH) small subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A230 2.51e-50 157 63 0 108 3 nirD Nitrite reductase (NADH) small subunit Salmonella typhi
P0A9I8 3.73e-48 152 62 0 106 1 nirD Nitrite reductase (NADH) small subunit Escherichia coli (strain K12)
P0A9I9 3.73e-48 152 62 0 106 3 nirD Nitrite reductase (NADH) small subunit Escherichia coli O157:H7
Q06458 4.99e-16 75 39 2 104 3 nasB Nitrite reductase [NAD(P)H] large subunit Klebsiella oxytoca
P22944 0.0002 42 31 4 93 3 niiA Nitrite reductase [NAD(P)H] Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_07500
Feature type CDS
Gene nirD
Product nitrite reductase small subunit NirD
Location 13261 - 13596 (strand: -1)
Length 336 (nucleotides) / 111 (amino acids)

Contig

Accession contig_8
Length 164760 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1269
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13806 Rieske-like [2Fe-2S] domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2146 Inorganic ion transport and metabolism (P)
Secondary metabolites biosynthesis, transport and catabolism (Q)		 PQ Ferredoxin subunit of nitrite reductase or a ring-hydroxylating dioxygenase

Kegg Ortholog Annotation(s)

Protein Sequence

MSQWITVCQVSDITPGTGVCALVKGEQVALFRPYPDERIFALSNIDPFAQASVLSRGLIAEHDGALWIVSPLKKQRFRLTDGLCAEDAAYSVAAFAVKVTDGTVSVSAVSQ

Flanking regions ( +/- flanking 50bp)

GCCCGTCCGGAAGAGCGGATTGCTGTAACTCTGATCGGGGAGGAATAATCATGAGTCAATGGATTACGGTTTGTCAGGTCAGTGATATCACCCCGGGAACCGGTGTGTGTGCGCTGGTAAAGGGTGAACAGGTGGCGCTGTTCCGTCCTTATCCGGACGAGCGCATTTTTGCCCTGAGTAATATCGATCCTTTTGCGCAGGCCAGTGTGCTGTCGCGCGGATTAATTGCAGAGCATGACGGCGCGCTGTGGATTGTCAGTCCGCTGAAAAAACAGCGTTTCCGGCTGACGGACGGGTTGTGTGCGGAAGACGCCGCATATTCCGTCGCCGCCTTTGCCGTTAAGGTGACGGATGGCACTGTGAGTGTTTCCGCCGTGTCGCAGTAACCCCATACAAAAAAAAGCGCAAAATGACTGAGGGCATTTTGCGCTTAATA