Homologs in group_1328

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07500 FBDBKF_07500 78.4 Morganella morganii S1 nirD nitrite reductase small subunit NirD
EHELCC_17170 EHELCC_17170 78.4 Morganella morganii S2 nirD nitrite reductase small subunit NirD
NLDBIP_13775 NLDBIP_13775 78.4 Morganella morganii S4 nirD nitrite reductase small subunit NirD
LHKJJB_09075 LHKJJB_09075 78.4 Morganella morganii S3 nirD nitrite reductase small subunit NirD
HKOGLL_08625 HKOGLL_08625 78.4 Morganella morganii S5 nirD nitrite reductase small subunit NirD
PMI_RS07155 PMI_RS07155 69.1 Proteus mirabilis HI4320 nirD nitrite reductase small subunit NirD

Distribution of the homologs in the orthogroup group_1328

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1328

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A229 5.64e-51 159 64 0 107 4 nirD Nitrite reductase (NADH) small subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A230 5.64e-51 159 64 0 107 3 nirD Nitrite reductase (NADH) small subunit Salmonella typhi
P0A9I8 6.09e-49 154 61 0 107 1 nirD Nitrite reductase (NADH) small subunit Escherichia coli (strain K12)
P0A9I9 6.09e-49 154 61 0 107 3 nirD Nitrite reductase (NADH) small subunit Escherichia coli O157:H7
Q06458 3.55e-15 73 36 1 101 3 nasB Nitrite reductase [NAD(P)H] large subunit Klebsiella oxytoca
P22944 8.04e-05 43 30 5 107 3 niiA Nitrite reductase [NAD(P)H] Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13610
Feature type CDS
Gene nirD
Product nitrite reductase small subunit NirD
Location 356916 - 357254 (strand: 1)
Length 339 (nucleotides) / 112 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1328
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13806 Rieske-like [2Fe-2S] domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2146 Inorganic ion transport and metabolism (P)
Secondary metabolites biosynthesis, transport and catabolism (Q)
PQ Ferredoxin subunit of nitrite reductase or a ring-hydroxylating dioxygenase

Kegg Ortholog Annotation(s)

Protein Sequence

MSHWITVCQISDITPGTGVCALVNGEQVALFRPYNDDQIFALSNIDPFAKASVLSRGLIAEHDNELWIVSPLKKQHFRLTDGLCLEDAAYSVAHFAVRTEGGAIRIHTAPQQ

Flanking regions ( +/- flanking 50bp)

GCCCGTCCTGAAGAGCGGATAGCCGTAACACTTATCGGGGAGGAGTAATGATGAGCCACTGGATAACAGTATGTCAGATAAGTGATATCACGCCGGGAACCGGCGTTTGTGCACTGGTAAATGGAGAGCAGGTTGCGCTGTTCCGCCCTTACAATGACGACCAGATTTTTGCATTAAGCAATATTGACCCCTTTGCAAAAGCCAGTGTGTTGTCACGCGGGTTAATCGCAGAACATGACAATGAATTGTGGATTGTCAGCCCGCTGAAAAAACAGCACTTTCGCTTAACGGATGGTCTGTGTCTTGAGGATGCCGCCTATTCTGTTGCTCATTTTGCCGTACGGACAGAAGGTGGAGCGATCCGTATTCATACGGCACCACAGCAATAAAAAACACAAAAAGCGGTACGGATAATATGTATTACCGTACCGCACTTACA