Homologs in group_1019

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11900 EHELCC_11900 100.0 Morganella morganii S2 - Oxidoreductase
NLDBIP_12240 NLDBIP_12240 100.0 Morganella morganii S4 - Oxidoreductase
LHKJJB_12100 LHKJJB_12100 100.0 Morganella morganii S3 - Oxidoreductase
HKOGLL_10715 HKOGLL_10715 100.0 Morganella morganii S5 - Oxidoreductase
F4V73_RS03615 F4V73_RS03615 82.1 Morganella psychrotolerans - DUF1289 domain-containing protein
PMI_RS06720 PMI_RS06720 61.5 Proteus mirabilis HI4320 - DUF1289 domain-containing protein

Distribution of the homologs in the orthogroup group_1019

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1019

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64475 1.22e-25 93 55 1 77 4 ydhL Uncharacterized protein YdhL Shigella flexneri
P64474 1.22e-25 93 55 1 77 4 ydhL Uncharacterized protein YdhL Escherichia coli (strain K12)
Q8CW10 1.33e-24 90 54 1 77 4 ydhL Uncharacterized protein YdhL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05690
Feature type CDS
Gene -
Product Oxidoreductase
Location 145244 - 145480 (strand: -1)
Length 237 (nucleotides) / 78 (amino acids)

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1019
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06945 Protein of unknown function (DUF1289)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3313 General function prediction only (R) R Predicted Fe-S protein YdhL, DUF1289 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06938 uncharacterized protein - -

Protein Sequence

MAEQLHFFDIPSPCVGICQLNEKGYCRGCYRSRDERFQWLSLSNAQKENVIRLCRQRRYRAAKGDSPPEAPSGQLDLF

Flanking regions ( +/- flanking 50bp)

GGATAACCATTACCTGTCCGGCAGGGCATCAGACAAAAGGACATCAGCCGATGGCAGAACAACTTCACTTTTTTGATATCCCTTCACCTTGTGTGGGGATATGTCAGCTGAATGAAAAAGGCTACTGCCGGGGATGCTACCGGAGCCGTGATGAGCGTTTTCAGTGGCTGTCACTGAGTAACGCACAAAAAGAAAATGTGATTCGGCTGTGCCGTCAGCGTCGTTACAGAGCCGCAAAAGGGGACTCACCACCGGAAGCGCCATCCGGACAGCTGGATTTATTTTAAATAAATAATTATAAATCTATATATTAGACATGAATTAATGTATGGATGTT