Homologs in group_965

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_12275 EHELCC_12275 100.0 Morganella morganii S2 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
NLDBIP_12615 NLDBIP_12615 100.0 Morganella morganii S4 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
LHKJJB_12475 LHKJJB_12475 100.0 Morganella morganii S3 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
HKOGLL_11090 HKOGLL_11090 100.0 Morganella morganii S5 dppC ABC-type dipeptide/oligopeptide/nickel transport system, permease component
F4V73_RS05770 F4V73_RS05770 96.7 Morganella psychrotolerans - ABC transporter permease
PMI_RS07175 PMI_RS07175 78.8 Proteus mirabilis HI4320 - ABC transporter permease

Distribution of the homologs in the orthogroup group_965

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_965

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77463 7.47e-71 223 44 0 266 1 ddpC Probable D,D-dipeptide transport system permease protein DdpC Escherichia coli (strain K12)
P94312 1.87e-70 222 40 2 269 3 dppC Dipeptide transport system permease protein DppC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
A0A0H2ZFV0 3.21e-63 203 44 3 272 1 dppC Di/tripeptide transport system permease protein DppC Pseudomonas aeruginosa (strain UCBPP-PA14)
P51000 8.91e-62 199 38 1 271 3 dppC Dipeptide transport system permease protein DppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42063 2.46e-59 193 36 3 272 3 appC Oligopeptide transport system permease protein AppC Bacillus subtilis (strain 168)
Q83S25 9.27e-59 192 39 1 268 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri
P0C2L2 9.27e-59 192 39 1 268 3 gsiD Glutathione transport system permease protein GsiD Shigella flexneri serotype 5b (strain 8401)
Q3Z3V1 2.34e-58 191 40 3 270 3 gsiD Glutathione transport system permease protein GsiD Shigella sonnei (strain Ss046)
Q323W2 2.34e-58 191 40 3 270 3 gsiD Glutathione transport system permease protein GsiD Shigella boydii serotype 4 (strain Sb227)
Q8X6V6 2.34e-58 191 40 3 270 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O157:H7
Q8FJK8 2.73e-58 191 39 1 268 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJL6 2.73e-58 191 39 1 268 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P75799 3.04e-58 191 40 3 270 1 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain K12)
Q1RE93 9.74e-58 189 40 3 270 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli (strain UTI89 / UPEC)
A1A971 9.74e-58 189 40 3 270 3 gsiD Glutathione transport system permease protein GsiD Escherichia coli O1:K1 / APEC
Q32IB8 1.11e-57 189 39 1 268 3 gsiD Glutathione transport system permease protein GsiD Shigella dysenteriae serotype 1 (strain Sd197)
P0AEG1 1.26e-56 186 41 2 273 1 dppC Dipeptide transport system permease protein DppC Escherichia coli (strain K12)
P0AEG2 1.26e-56 186 41 2 273 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEG3 1.26e-56 186 41 2 273 3 dppC Dipeptide transport system permease protein DppC Escherichia coli O157:H7
Q6D3B2 1.57e-55 184 39 1 265 3 gsiD Glutathione transport system permease protein GsiD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7CQV4 1.06e-54 181 40 3 263 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XF88 1.06e-54 181 40 3 263 3 gsiD Glutathione transport system permease protein GsiD Salmonella typhi
Q5PGP6 1.06e-54 181 40 3 263 3 gsiD Glutathione transport system permease protein GsiD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57RA9 1.06e-54 181 40 3 263 3 gsiD Glutathione transport system permease protein GsiD Salmonella choleraesuis (strain SC-B67)
P0AFA9 4.77e-54 179 42 0 243 1 nikC Nickel transport system permease protein NikC Escherichia coli (strain K12)
P0AFB0 4.77e-54 179 42 0 243 3 nikC Nickel transport system permease protein NikC Escherichia coli O157:H7
Q8FUW9 5.21e-51 172 38 2 281 3 BRA1093 Putative peptide transport system permease protein BRA1093/BS1330_II1085 Brucella suis biovar 1 (strain 1330)
Q8YDG8 5.93e-51 172 39 1 242 3 BMEII0207/BMEII0208 Putative peptide transport system permease protein BMEII0207/BMEII0208 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YJK0 5.93e-51 172 39 1 242 3 BAB2_1051 Putative peptide transport system permease protein BAB2_1051 Brucella abortus (strain 2308)
Q8VQK5 5.93e-51 172 39 1 242 3 BruAb2_1032 Putative peptide transport system permease protein BruAb2_1032 Brucella abortus biovar 1 (strain 9-941)
P26904 1.65e-50 171 33 1 268 2 dppC Dipeptide transport system permease protein DppC Bacillus subtilis (strain 168)
A0A0H3JU73 1.43e-47 163 31 0 272 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FVE9 1.48e-47 162 31 0 272 1 cntC Metal-staphylopine import system permease protein CntC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q53192 1.56e-45 157 38 3 240 3 NGR_a01420 Probable peptide ABC transporter permease protein y4tQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P24139 6.44e-45 156 33 0 267 1 oppC Oligopeptide transport system permease protein OppC Bacillus subtilis (strain 168)
Q7A0Y0 4.76e-43 150 35 0 219 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MW2)
Q6G9H9 4.76e-43 150 35 0 219 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MSSA476)
Q5HG39 4.76e-43 150 35 0 219 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain COL)
Q2FYQ6 4.76e-43 150 35 0 219 1 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH56 4.76e-43 150 35 0 219 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain USA300)
Q2YXY8 8.66e-43 150 31 0 251 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A5Q7 1.06e-42 150 34 0 219 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain N315)
Q99UA1 1.06e-42 150 34 0 219 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GH26 2.22e-42 149 31 0 251 3 nikC Nickel import system permease protein NikC Staphylococcus aureus (strain MRSA252)
Q8FWN9 2.84e-41 147 33 4 273 3 BRA0407 Putative peptide permease protein BRA0407/BS1330_II0404 Brucella suis biovar 1 (strain 1330)
A5VU89 1.54e-40 145 33 4 273 3 BOV_A0350 Putative peptide permease protein BOV_A0350 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YBN8 1.83e-40 145 33 4 273 3 BMEII0861 Putative peptide permease protein BMEII0861 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YK65 1.83e-40 145 33 4 273 3 BAB2_0815 Putative peptide permease protein BAB2_0815 Brucella abortus (strain 2308)
Q577J7 1.83e-40 145 33 4 273 3 BruAb2_0794 Putative peptide permease protein BruAb2_0794 Brucella abortus biovar 1 (strain 9-941)
P0A2J5 1.29e-37 137 34 1 267 2 sapC Peptide transport system permease protein SapC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J6 1.29e-37 137 34 1 267 3 sapC Peptide transport system permease protein SapC Salmonella typhi
P0AGH7 2.04e-37 137 34 1 267 3 sapC Peptide transport system permease protein SapC Shigella flexneri
P0AGH5 2.04e-37 137 34 1 267 1 sapC Putrescine export system permease protein SapC Escherichia coli (strain K12)
P0AGH6 2.04e-37 137 34 1 267 3 sapC Peptide transport system permease protein SapC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P08006 1.31e-33 127 31 4 265 1 oppC Oligopeptide transport system permease protein OppC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45053 9.53e-33 125 30 3 247 3 oppC Oligopeptide transport system permease protein OppC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P66965 1.31e-32 124 31 2 247 3 BQ2027_MB1313C Putative peptide transport permease protein Mb1313c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFZ9 1.31e-32 124 31 2 247 1 Rv1282c Putative peptide transport permease protein Rv1282c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFZ8 1.31e-32 124 31 2 247 3 MT1319 Putative peptide transport permease protein MT1319 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0AFH6 4.25e-31 120 28 1 269 1 oppC Oligopeptide transport system permease protein OppC Escherichia coli (strain K12)
P0AFH7 4.25e-31 120 28 1 269 3 oppC Oligopeptide transport system permease protein OppC Escherichia coli O157:H7
P45287 1.16e-30 119 31 3 279 3 sapC Peptide transport system permease protein SapC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A4P0 1.73e-24 102 26 5 278 3 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. cremoris (strain SK11)
P0A4N9 2.67e-24 102 26 5 278 1 oppC Oligopeptide transport system permease protein OppC Lactococcus lactis subsp. lactis (strain IL1403)
A2RI76 4.31e-24 102 27 0 220 1 dppC Dipeptide transport system permease protein DppC Lactococcus lactis subsp. cremoris (strain MG1363)
Q7D203 4.59e-24 103 31 4 223 3 yejE Peptidoglycan transport system permease protein YejE Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A4N0 8.88e-23 98 21 2 275 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4M9 8.88e-23 98 21 2 275 3 amiD Oligopeptide transport system permease protein AmiD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P33915 1.11e-20 93 29 4 227 1 yejE Inner membrane ABC transporter permease protein YejE Escherichia coli (strain K12)
P75553 8.6e-06 50 26 5 183 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47324 3.18e-05 48 25 3 171 3 oppC Oligopeptide transport system permease protein OppC Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_05315
Feature type CDS
Gene dppC
Product ABC-type dipeptide/oligopeptide/nickel transport system, permease component
Location 70493 - 71317 (strand: 1)
Length 825 (nucleotides) / 274 (amino acids)

Contig

Accession contig_5
Length 181448 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_965
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component
PF12911 N-terminal TM domain of oligopeptide transport permease C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1173 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)		 EP ABC-type dipeptide/oligopeptide/nickel transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02034 peptide/nickel transport system permease protein Quorum sensing -

Protein Sequence

MTLLPKIRRSPSALTGTLIILFLLLVALFAPWLAPYDPVLQNPAQRLLAPDAQHWLGTDSYGRDMLSRLIYGTRPMFGLVALVAAITLPAGLLIGILAGFYGRWVETILMRFTDIVMSMPRLILAFAFVAILGPGLINGALALALTSWPAYARQARSEIRHLRNSDYLASAEMLGIRGLRLLWGHILPLCLPSAIVRLALDLATIILAAAGLGFLGLGAQPPMAEWGAMIADGMQVIFDQWWIAAVPGAAILIAGMAFNLLGDGLRDIMEPQHD

Flanking regions ( +/- flanking 50bp)

AATAACGTGACCGATATGATTGTGCGTTTAACGGATCCGCGGGTGAAATCATGACATTACTGCCGAAAATCCGCCGTTCCCCGTCCGCGCTGACGGGCACCCTGATTATTCTGTTTCTGCTGCTGGTGGCGTTGTTTGCGCCGTGGCTCGCCCCTTATGACCCGGTACTGCAAAACCCGGCACAACGCCTGCTGGCACCGGATGCTCAACACTGGCTCGGAACGGACAGCTACGGACGTGATATGCTCTCCCGCCTGATCTACGGCACCCGCCCGATGTTTGGTCTGGTTGCACTGGTCGCAGCAATCACCCTGCCCGCCGGGTTATTGATCGGCATTCTGGCCGGATTTTACGGCCGCTGGGTGGAAACGATTCTGATGCGCTTTACCGATATTGTCATGTCGATGCCGCGCCTGATCCTCGCGTTTGCCTTTGTTGCTATTCTCGGCCCGGGGCTGATTAACGGCGCACTGGCTCTCGCCCTGACCTCGTGGCCCGCCTATGCCCGCCAGGCACGCAGTGAAATCCGCCATCTGCGCAACAGTGATTATCTGGCCAGTGCGGAAATGCTGGGGATCCGTGGTCTGCGTCTGCTGTGGGGACACATTCTGCCGCTCTGTCTGCCGTCAGCTATTGTCCGGCTGGCACTGGATCTCGCCACCATTATCCTGGCGGCCGCCGGTCTGGGTTTCCTCGGGCTGGGCGCACAACCGCCGATGGCGGAATGGGGAGCCATGATTGCTGATGGTATGCAGGTTATTTTTGACCAGTGGTGGATAGCCGCCGTTCCCGGCGCGGCCATTCTGATTGCCGGTATGGCATTCAATCTTCTGGGTGATGGTTTACGGGATATTATGGAGCCGCAACATGACTGAGCCGCTTATTTGTGTCCGTAATTTGTGTGTGGATTACCCCCGCGCACAAG