Homologs in group_3206

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03065 EHELCC_03065 100.0 Morganella morganii S2 - L-lysine permease
NLDBIP_00395 NLDBIP_00395 100.0 Morganella morganii S4 - L-lysine permease
LHKJJB_01640 LHKJJB_01640 100.0 Morganella morganii S3 - L-lysine permease
HKOGLL_01680 HKOGLL_01680 100.0 Morganella morganii S5 - L-lysine permease

Distribution of the homologs in the orthogroup group_3206

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3206

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75693 1.71e-23 90 67 0 62 3 yahN Uncharacterized membrane protein YahN Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02595
Feature type CDS
Gene -
Product L-lysine permease
Location 216077 - 216274 (strand: -1)
Length 198 (nucleotides) / 65 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3206
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Protein Sequence

MDPLHSIAVTLFLFVLTFFNPGANLFIVAQTTLSSGQKAGLTCGYGVVLGNAIYSGLGLFGLVKV

Flanking regions ( +/- flanking 50bp)

CCGCGATTTTTCGTTAAGCTGAATTAAGCTTTTCCGGGGAGAACCCCGTTATGGATCCGCTGCACAGCATTGCCGTCACGCTTTTTTTGTTTGTCCTGACTTTTTTCAATCCCGGGGCAAATCTGTTTATTGTTGCGCAGACCACACTGAGTTCCGGACAAAAAGCGGGGCTGACCTGCGGTTACGGCGTGGTGCTGGGCAATGCGATTTACTCGGGGCTGGGATTATTCGGGCTGGTGAAGGTGTAGGTCAGCCCCGCACGGTGGCTGTAAGCTGAGGTATCACTGTTTTGTGTTGT