Homologs in group_503

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_00560 EHELCC_00560 100.0 Morganella morganii S2 cysW sulfate/thiosulfate ABC transporter permease CysW
NLDBIP_02900 NLDBIP_02900 100.0 Morganella morganii S4 cysW sulfate/thiosulfate ABC transporter permease CysW
LHKJJB_04415 LHKJJB_04415 100.0 Morganella morganii S3 cysW sulfate/thiosulfate ABC transporter permease CysW
HKOGLL_02630 HKOGLL_02630 100.0 Morganella morganii S5 cysW sulfate/thiosulfate ABC transporter permease CysW
F4V73_RS07060 F4V73_RS07060 87.1 Morganella psychrotolerans cysW sulfate/thiosulfate ABC transporter permease CysW
PMI_RS09045 PMI_RS09045 65.7 Proteus mirabilis HI4320 cysW sulfate/thiosulfate ABC transporter permease CysW

Distribution of the homologs in the orthogroup group_503

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_503

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEB0 4.6e-127 365 64 3 288 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 4.6e-127 365 64 3 288 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P27370 1.78e-80 247 47 1 261 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P74547 3.17e-79 244 51 1 235 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6QJE2 1.69e-68 219 47 1 233 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
Q9MUL9 3.34e-35 130 34 3 227 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
Q9TJR4 5.32e-35 129 33 3 253 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
A2CI71 6.03e-35 130 32 3 237 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
Q9TKU8 2.69e-33 125 32 5 278 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
P56343 3.45e-33 125 39 3 192 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
Q32RF7 3.07e-32 123 30 3 255 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
P16701 6.68e-32 122 36 2 198 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
P41032 2.1e-31 120 37 2 194 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P26246 1.49e-30 119 30 2 243 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
Q8RVC7 1.24e-29 119 33 1 236 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
Q2EEX6 7.5e-28 111 29 1 238 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P27367 3.51e-27 109 31 2 252 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q01895 2.4e-26 107 37 3 182 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q85AI0 3.56e-25 104 29 2 218 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
P45322 1.13e-20 91 32 1 201 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P18795 5.25e-20 90 27 4 263 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
O30143 1.27e-18 86 31 1 173 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P0AF01 6.07e-16 78 32 0 182 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 6.07e-16 78 32 0 182 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
Q5JEB3 1.34e-15 77 28 4 213 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P9WG13 1.42e-15 77 38 1 125 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 1.42e-15 77 38 1 125 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 1.42e-15 77 38 1 125 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
D4GQ17 7.72e-15 75 33 3 210 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q08382 1.07e-14 74 31 5 210 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
Q8U4K4 6.75e-14 72 27 3 191 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P37731 5.72e-13 70 29 1 184 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
Q58763 2.18e-12 68 23 3 201 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O32209 1.44e-11 66 26 0 186 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
Q9V2C1 8.82e-10 61 22 4 210 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
O57893 2.53e-09 60 23 3 193 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P96064 6.13e-07 53 27 5 199 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 6.64e-07 53 27 5 199 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57SD7 1.02e-06 52 27 5 199 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
Q8Z8W9 4.48e-06 50 26 5 199 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
P55602 9.51e-06 49 25 4 187 3 NGR_a02190 Probable ABC transporter permease protein y4oQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P31549 1.63e-05 49 25 4 206 1 thiP Thiamine transport system permease protein ThiP Escherichia coli (strain K12)
P21409 3.64e-05 48 25 4 208 3 fbpB Fe(3+)-transport system permease protein SfuB Serratia marcescens
Q8ZRV1 3.94e-05 48 26 4 206 1 thiP Thiamine transport system permease protein ThiP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57341 8.62e-05 47 22 4 213 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44123 0.000106 47 22 2 209 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
O50501 0.000372 45 24 6 202 1 ngcG Diacetylchitobiose uptake system permease protein NgcG Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O51924 0.000374 44 26 4 185 1 malF Trehalose/maltose transport system permease protein MalF Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
P47290 0.000775 43 22 4 183 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q87C90 0.000881 43 25 5 182 3 pstC Phosphate transport system permease protein PstC Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P0AFR8 0.001 43 26 9 244 3 ycjO Inner membrane ABC transporter permease protein YcjO Shigella flexneri
P0AFR7 0.001 43 26 9 244 1 ycjO Inner membrane ABC transporter permease protein YcjO Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_00985
Feature type CDS
Gene cysW
Product sulfate/thiosulfate ABC transporter permease CysW
Location 179142 - 179984 (strand: -1)
Length 843 (nucleotides) / 280 (amino acids)

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_503
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4208 Inorganic ion transport and metabolism (P) P ABC-type sulfate transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02047 sulfate/thiosulfate transport system permease protein Sulfur metabolism
ABC transporters		 Sulfate-sulfur assimilation

Protein Sequence

MADTLRRRRFPWQKWLLISAGLLLTFFILVIPLVWIFVTALSDGIGGVIRALAEADMLHAIWLTVIVALITVPVNLIFGTLLAWLVTRFRFPGRQLLLTLVDLPFAVSPVIAGLLYLLLYGSNSWLGGFLENSLNTQIMFALPGIVLVTIFVTCPYVVRELVPVMLSQGAQEEEAAVLLGARAWQIWWRVTLPNIRWPLFYGVILTNARAIGEFGAVSVVSGAIRGETFTLPLQVELLHQDYQTVAAFTASGLLALMAVVTLCIRHGVMAYQGSRRKYEH

Flanking regions ( +/- flanking 50bp)

GGCGGTCAATATTATTCAGAGCCGCGCCGGATTGCGTACCGGGAGGTCTCATGGCTGATACACTACGCCGCCGGCGTTTCCCGTGGCAGAAGTGGCTGCTGATTTCTGCCGGGCTGCTGCTGACATTTTTCATCCTGGTTATTCCGCTGGTGTGGATTTTTGTGACCGCGCTGTCTGATGGTATCGGCGGTGTGATCCGTGCACTGGCGGAGGCGGATATGCTGCATGCTATCTGGCTGACAGTGATCGTAGCGCTGATCACCGTGCCGGTAAATCTGATTTTCGGCACACTGCTGGCGTGGCTGGTAACACGGTTTCGTTTTCCCGGCCGCCAGTTATTGCTGACACTGGTGGATCTGCCGTTTGCGGTATCGCCGGTGATCGCCGGGCTGTTGTATCTGCTGCTGTACGGCTCAAACAGCTGGCTGGGTGGCTTTCTCGAAAACTCGCTGAATACCCAGATTATGTTTGCGTTGCCGGGAATTGTGCTGGTGACGATTTTCGTAACCTGTCCTTATGTGGTGCGGGAACTGGTGCCGGTGATGCTCAGTCAGGGTGCACAGGAAGAAGAGGCCGCCGTGCTGCTGGGGGCCCGTGCATGGCAGATCTGGTGGCGGGTGACACTGCCGAATATCCGCTGGCCGCTGTTTTACGGTGTGATCCTGACCAACGCCCGCGCTATCGGGGAGTTTGGTGCGGTGTCGGTGGTTTCCGGCGCAATTCGGGGAGAAACCTTCACTTTACCGTTACAGGTGGAATTATTGCATCAGGATTATCAGACCGTGGCAGCATTTACCGCATCCGGTCTGCTGGCGCTGATGGCTGTTGTGACCCTGTGCATCCGCCATGGCGTGATGGCATATCAGGGATCCCGGAGGAAATATGAGCATTGAAATCCGTCATCTGACACACCATTTCGGTACGGAGCCGGTATTACAGGATA