Homologs in group_503

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00985 FBDBKF_00985 87.1 Morganella morganii S1 cysW sulfate/thiosulfate ABC transporter permease CysW
EHELCC_00560 EHELCC_00560 87.1 Morganella morganii S2 cysW sulfate/thiosulfate ABC transporter permease CysW
NLDBIP_02900 NLDBIP_02900 87.1 Morganella morganii S4 cysW sulfate/thiosulfate ABC transporter permease CysW
LHKJJB_04415 LHKJJB_04415 87.1 Morganella morganii S3 cysW sulfate/thiosulfate ABC transporter permease CysW
HKOGLL_02630 HKOGLL_02630 87.1 Morganella morganii S5 cysW sulfate/thiosulfate ABC transporter permease CysW
PMI_RS09045 PMI_RS09045 64.7 Proteus mirabilis HI4320 cysW sulfate/thiosulfate ABC transporter permease CysW

Distribution of the homologs in the orthogroup group_503

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_503

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEB0 5.67e-126 363 65 3 286 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 5.67e-126 363 65 3 286 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P27370 1.05e-78 243 50 1 238 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P74547 7.6e-78 240 51 1 241 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6QJE2 1.67e-65 212 46 1 263 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
Q9TKU8 8.68e-33 124 33 3 239 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q32RF7 2.42e-32 123 31 7 282 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
P41032 4.25e-32 122 38 2 190 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9TJR4 8.79e-32 121 30 1 248 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
Q9MUL9 1.31e-31 121 34 3 216 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
P16701 6.82e-31 119 38 2 187 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
A2CI71 1.1e-30 119 34 3 208 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
P56343 1.35e-29 115 36 3 192 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
P26246 9.14e-29 114 28 1 265 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
Q01895 2.51e-27 110 37 3 182 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2EEX6 4.04e-27 109 29 2 239 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P27367 7.83e-27 108 31 1 247 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8RVC7 2.37e-26 110 33 1 209 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
Q85AI0 4.29e-23 99 30 2 218 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
O30143 9.97e-21 92 28 3 233 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P45322 4.32e-20 89 33 1 217 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AF01 2.45e-18 85 32 2 224 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 2.45e-18 85 32 2 224 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
P18795 7.91e-18 84 26 2 227 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
D4GQ17 1.92e-14 75 33 4 203 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P9WG13 4.93e-14 73 36 1 125 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 4.93e-14 73 36 1 125 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 4.93e-14 73 36 1 125 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q08382 1.01e-13 72 31 3 191 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
Q5JEB3 2.54e-13 71 28 4 213 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q58763 1.04e-12 69 27 3 178 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8U4K4 4.25e-12 68 26 2 191 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P37731 6.55e-12 67 28 2 228 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
O32209 5.73e-10 61 28 0 173 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
Q9V2C1 4.66e-09 59 26 2 163 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
O57893 3.58e-08 56 23 5 255 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P96064 6.12e-07 53 26 6 209 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 7.75e-07 53 26 6 209 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57SD7 1.32e-06 52 26 6 209 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
P55602 1.49e-06 52 26 8 282 3 NGR_a02190 Probable ABC transporter permease protein y4oQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8Z8W9 5.3e-06 50 26 6 209 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
P47290 1.35e-05 49 24 3 174 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75057 1.74e-05 48 26 3 174 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8ZRV1 9.75e-05 47 25 4 206 1 thiP Thiamine transport system permease protein ThiP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q44123 0.000168 46 24 3 201 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q0P886 0.000302 45 23 4 242 1 tupB Tungstate uptake system permease protein TupB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q57BC3 0.000444 45 28 3 161 3 thiP Thiamine transport system permease protein ThiP Brucella abortus biovar 1 (strain 9-941)
Q2YLW7 0.000444 45 28 3 161 3 thiP Thiamine transport system permease protein ThiP Brucella abortus (strain 2308)
P21409 0.000607 44 23 3 224 3 fbpB Fe(3+)-transport system permease protein SfuB Serratia marcescens
P31549 0.000805 44 23 4 206 1 thiP Thiamine transport system permease protein ThiP Escherichia coli (strain K12)
Q8FYV0 0.001 44 28 3 161 3 thiP Thiamine transport system permease protein ThiP Brucella suis biovar 1 (strain 1330)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07060
Feature type CDS
Gene cysW
Product sulfate/thiosulfate ABC transporter permease CysW
Location 1465623 - 1466480 (strand: -1)
Length 858 (nucleotides) / 285 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_503
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4208 Inorganic ion transport and metabolism (P) P ABC-type sulfate transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02047 sulfate/thiosulfate transport system permease protein Sulfur metabolism
ABC transporters		 Sulfate-sulfur assimilation

Protein Sequence

MADNFRRRPRFAWQKWLLIAAGMLLTLGILIIPLGWIFVTALSDGIAGVLKALGEADTQHAIWLTLIVALITVPVNLVFGTLLAWLVTRFRFPGRQLLLTLADLPFAVSPVIAGLLYLLLYGANGWLGSFFEDDLNTQIMFALPGIVLVTIFVTCPYVVRELVPVMLSQGAQEEEAAVLLGASAHQIWWHITLPNIRWPLFYGVILTNARAIGEFGAVSVVSGAIRGETFTLPLQVELLHQDYQTVAAFTAAGLLALMAVVTLFIRHGVSWYLARRALSGRHYEH

Flanking regions ( +/- flanking 50bp)

TACCGTCAATATTATTCAGAGCCGTGTTGGTTTGCGGACAGGCGGGGCACATGGCTGATAATTTCCGTCGCCGCCCGCGTTTTGCGTGGCAAAAATGGTTGCTGATTGCCGCCGGGATGCTGCTCACACTCGGGATCTTAATTATTCCGCTTGGCTGGATTTTTGTGACCGCACTGTCTGATGGTATTGCCGGTGTCCTGAAAGCACTGGGCGAGGCGGATACACAGCATGCTATCTGGCTGACACTGATTGTTGCGTTGATCACCGTGCCGGTAAACCTGGTCTTCGGCACATTGCTTGCGTGGCTTGTTACCCGGTTTCGTTTTCCCGGTCGTCAGCTGTTACTGACGCTGGCGGATTTACCGTTTGCGGTGTCACCTGTTATCGCCGGTTTGCTCTATTTATTACTGTATGGCGCAAATGGCTGGCTGGGCAGTTTTTTTGAAGATGACCTTAATACACAGATTATGTTTGCGCTGCCGGGTATTGTGCTGGTAACTATATTTGTCACCTGTCCTTATGTGGTGCGGGAACTGGTACCGGTGATGCTCAGTCAGGGCGCGCAGGAAGAAGAGGCGGCGGTGCTGCTCGGTGCGTCGGCGCACCAGATTTGGTGGCACATTACCTTACCCAATATCCGCTGGCCGCTGTTTTACGGTGTGATCCTCACCAATGCGCGGGCGATAGGTGAATTTGGCGCGGTGTCTGTGGTATCAGGTGCTATTCGCGGTGAGACATTCACTCTGCCGTTACAGGTGGAACTCTTACATCAGGATTATCAAACCGTCGCGGCATTTACGGCCGCAGGATTGCTGGCGCTGATGGCTGTGGTGACACTGTTTATCCGCCACGGCGTGTCCTGGTATCTGGCTCGGCGGGCGTTGTCCGGGAGACATTATGAGCATTGAAATTACTAACCTTACACACCATTTCGGTGCAGACCCGGTACTGCGGGATA