Homologs in group_503

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00985 FBDBKF_00985 65.7 Morganella morganii S1 cysW sulfate/thiosulfate ABC transporter permease CysW
EHELCC_00560 EHELCC_00560 65.7 Morganella morganii S2 cysW sulfate/thiosulfate ABC transporter permease CysW
NLDBIP_02900 NLDBIP_02900 65.7 Morganella morganii S4 cysW sulfate/thiosulfate ABC transporter permease CysW
LHKJJB_04415 LHKJJB_04415 65.7 Morganella morganii S3 cysW sulfate/thiosulfate ABC transporter permease CysW
HKOGLL_02630 HKOGLL_02630 65.7 Morganella morganii S5 cysW sulfate/thiosulfate ABC transporter permease CysW
F4V73_RS07060 F4V73_RS07060 64.7 Morganella psychrotolerans cysW sulfate/thiosulfate ABC transporter permease CysW

Distribution of the homologs in the orthogroup group_503

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_503

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEB0 1.13e-145 413 72 0 280 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 1.13e-145 413 72 0 280 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P27370 2.41e-90 272 48 2 276 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P74547 1.88e-82 252 51 0 235 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6QJE2 1.48e-74 235 49 0 233 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
P16701 3.61e-43 151 40 1 199 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
P41032 2.55e-42 149 40 1 199 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9TKU8 1.34e-38 139 34 2 243 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q9MUL9 2.9e-38 138 34 0 218 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
A2CI71 2.79e-37 136 38 0 184 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
Q9TJR4 1.98e-36 133 32 0 225 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
Q8RVC7 9.84e-34 129 33 1 246 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
P56343 1.58e-33 126 32 0 237 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
Q32RF7 1.66e-33 126 31 1 245 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
Q2EEX6 2.88e-33 125 31 2 245 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P27367 7.56e-33 124 33 0 242 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P26246 4.63e-32 122 32 1 217 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
Q85AI0 4.15e-29 115 29 0 243 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
Q01895 6.7e-27 108 36 2 181 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P45322 1.67e-26 106 35 2 201 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AF01 8.33e-23 96 34 2 207 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 8.33e-23 96 34 2 207 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
Q5JEB3 1.13e-21 94 27 4 250 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P18795 5.51e-21 93 26 3 241 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
O30143 1.76e-19 88 27 3 230 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8U4K4 3.72e-19 87 25 5 265 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q58763 1.57e-16 80 28 5 175 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P37731 3.02e-16 79 29 1 183 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
D4GQ17 3.59e-16 79 29 3 227 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O57893 2.66e-15 77 24 4 250 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P9WG13 2.99e-15 77 35 2 179 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 2.99e-15 77 35 2 179 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 2.99e-15 77 35 2 179 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9V2C1 5.25e-14 73 23 4 251 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
Q08382 2.02e-13 71 29 3 187 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
O32209 4.86e-13 70 28 4 194 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
Q57SD7 5.53e-09 59 26 6 225 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
P96064 1.6e-08 57 26 6 225 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 1.78e-08 57 26 6 225 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8W9 1.43e-07 55 25 6 225 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
P31549 3.01e-07 54 26 3 215 1 thiP Thiamine transport system permease protein ThiP Escherichia coli (strain K12)
Q44123 3.82e-07 54 28 4 197 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q44123 2.83e-05 48 19 4 267 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q8ZRV1 1.08e-06 53 25 3 217 1 thiP Thiamine transport system permease protein ThiP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O50501 2.28e-06 51 27 6 188 1 ngcG Diacetylchitobiose uptake system permease protein NgcG Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0AFK5 2.53e-06 51 25 5 212 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 2.53e-06 51 25 5 212 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
P0CL49 1.2e-05 49 25 5 212 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 1.2e-05 49 25 5 212 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 1.2e-05 49 25 5 212 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
Q57341 1.26e-05 50 30 3 153 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0P886 2.89e-05 47 20 4 220 1 tupB Tungstate uptake system permease protein TupB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P21409 6.53e-05 47 25 3 186 3 fbpB Fe(3+)-transport system permease protein SfuB Serratia marcescens
Q57BC3 0.000128 46 25 3 177 3 thiP Thiamine transport system permease protein ThiP Brucella abortus biovar 1 (strain 9-941)
Q2YLW7 0.000128 46 25 3 177 3 thiP Thiamine transport system permease protein ThiP Brucella abortus (strain 2308)
Q87C90 0.000282 45 35 0 68 3 pstC Phosphate transport system permease protein PstC Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q93KD5 0.000374 44 22 5 202 1 tupB Tungstate uptake system permease protein TupB Peptoclostridium acidaminophilum
P55602 0.000401 44 25 3 158 3 NGR_a02190 Probable ABC transporter permease protein y4oQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8FYV0 0.000412 45 26 3 176 3 thiP Thiamine transport system permease protein ThiP Brucella suis biovar 1 (strain 1330)
Q9PBK2 0.000427 44 35 0 68 3 pstC Phosphate transport system permease protein PstC Xylella fastidiosa (strain 9a5c)
Q8YJ03 0.000471 45 25 3 177 3 thiP Thiamine transport system permease protein ThiP Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P46339 0.00057 44 25 9 278 3 yqgH Probable ABC transporter permease protein YqgH Bacillus subtilis (strain 168)
P9WG07 0.000772 43 47 0 53 2 pstC1 Phosphate transport system permease protein PstC 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG06 0.000772 43 47 0 53 3 pstC1 Phosphate transport system permease protein PstC 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A629 0.000772 43 47 0 53 3 pstC1 Phosphate transport system permease protein PstC 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS09045
Feature type CDS
Gene cysW
Product sulfate/thiosulfate ABC transporter permease CysW
Location 1970736 - 1971578 (strand: -1)
Length 843 (nucleotides) / 280 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_503
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4208 Inorganic ion transport and metabolism (P) P ABC-type sulfate transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02047 sulfate/thiosulfate transport system permease protein Sulfur metabolism
ABC transporters		 Sulfate-sulfur assimilation

Protein Sequence

MSDIAQQRSLYRRQIDWVKWGLILTGVVLSILFLVVPIAWIFMTAFSKGIEIFTDNLLDSDMLHAVWLTLLIALITVPINMLFGISMAWLVTRFRFPGRQWLMTLIDIPFAVSPVVAGLLYLLFYGSNGWAGQWLEQFDIQLMFSWPGMVLVTVFVTCPFVVRELVPVMMSQGSQEDEAAVLLGASSWKMFWRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGAIRGETYSLPLQVELLHQDYNTVGAFTAAALLAMMAIITLMVKSALQWHLERQQ

Flanking regions ( +/- flanking 50bp)

TCAATTAATGGATTACAAAGCCGCTTTGGCAAGCGATTAAGGGGGCACTAATGTCGGATATAGCGCAACAACGCTCTCTTTATCGTCGCCAAATTGATTGGGTAAAATGGGGATTGATCCTTACAGGCGTTGTGTTATCCATTTTATTTTTAGTGGTGCCTATTGCGTGGATCTTTATGACTGCGTTTTCAAAAGGCATAGAAATATTTACCGACAACTTGCTAGATAGCGATATGTTACATGCTGTTTGGCTTACGCTACTTATCGCTTTAATTACTGTACCGATAAATATGTTGTTTGGTATTAGTATGGCATGGCTTGTTACGCGTTTTCGTTTTCCGGGGCGTCAGTGGTTAATGACGCTGATTGATATCCCATTTGCGGTATCCCCTGTCGTTGCGGGACTGCTCTATCTACTTTTTTATGGTAGCAATGGTTGGGCAGGGCAGTGGTTGGAACAATTCGATATTCAGTTAATGTTCTCTTGGCCCGGTATGGTATTAGTGACGGTATTTGTCACTTGTCCTTTTGTCGTGAGAGAGCTTGTCCCAGTGATGATGAGCCAAGGAAGCCAAGAGGATGAAGCTGCTGTGTTATTAGGTGCCAGTAGTTGGAAAATGTTTTGGCGAGTGACATTACCTAATATTCGTTGGGCATTGCTCTACGGTGTGGTTTTAACAAATGCACGTGCTATAGGGGAATTTGGTGCCGTCTCTGTTGTCTCGGGGGCTATTCGTGGTGAAACCTATTCACTGCCTTTACAGGTCGAACTTTTGCACCAAGACTACAACACTGTGGGGGCTTTTACGGCAGCAGCATTACTTGCCATGATGGCAATTATTACATTAATGGTTAAAAGTGCGTTGCAATGGCATTTAGAACGTCAGCAATAACGCAAAACAGGGGCAAAATATGAGTATTGAAATTAATCATGTCACAAAAT