Homologs in group_3717
2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| F4V73_RS11520 | F4V73_RS11520 | 77.1 | Morganella psychrotolerans | speFL | leader peptide SpeFL |
| PMI_RS19215 | PMI_RS19215 | 74.3 | Proteus mirabilis HI4320 | speFL | leader peptide SpeFL |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P0DTV7 | 3.27e-09 | 48 | 64 | 0 | 34 | 1 | speFL | Leader peptide SpeFL | Escherichia coli (strain K12) |
| P0DTV8 | 5.92e-09 | 48 | 67 | 0 | 34 | 1 | speFL | Leader peptide SpeFL | Salmonella typhimurium (strain SL1344) |
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS19395 |
| Feature type | CDS |
| Gene | - |
| Product | hypothetical protein |
| Location | 385103 - 385222 (strand: 1) |
| Length | 120 (nucleotides) / 39 (amino acids) |
| In genomic island | - |
| Accession | NZ_VXKB01000001 |
|---|---|
| Length | 2012992 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3717 | |
|---|---|---|
| Orthogroup size | 3 | |
| N. genomes | 2 |
MENNNRSRPHIRRVTHLMQFSHRSCFDFSHFMARRSFPL
TGATGACCGCCATCCCGGCGGTCTTTCCGCCTGTTTCCGGAGTCTGCGCTATGGAAAATAATAACCGTTCCCGGCCGCACATCAGACGTGTCACACACCTGATGCAGTTTTCCCATCGCAGCTGCTTTGATTTCAGTCACTTTATGGCCCGCAGGTCATTTCCTCTGTAATTTCTGTATACCATCGTATTTTTACCTAAAAGCCCGTTTCTTTTTTTTCC
