Homologs in group_3722

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS19395 F4V73_RS19395 77.1 Morganella psychrotolerans - hypothetical protein
PMI_RS19215 PMI_RS19215 85.7 Proteus mirabilis HI4320 speFL leader peptide SpeFL

Distribution of the homologs in the orthogroup group_3722

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3722

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0DTV8 7.28e-11 52 70 0 34 1 speFL Leader peptide SpeFL Salmonella typhimurium (strain SL1344)
P0DTV7 3.54e-08 45 61 0 34 1 speFL Leader peptide SpeFL Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11520
Feature type CDS
Gene speFL
Product leader peptide SpeFL
Location 451629 - 451736 (strand: 1)
Length 108 (nucleotides) / 35 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3722
Orthogroup size 3
N. genomes 2

Actions

Genomic region

Domains

PF10940 Leader peptide SpeFL

Protein Sequence

MENNNRFWPHIRRVTHLMMFSHRSCFSFNRFNAKR

Flanking regions ( +/- flanking 50bp)

TATATTAGTACGAGTTCATTAATAAGTGCTGATTTAAAACAGGTGCAAAAATGGAAAATAACAATCGATTTTGGCCACATATAAGACGTGTTACACATCTGATGATGTTCTCACATCGCTCTTGCTTTAGTTTTAATCGTTTTAATGCAAAAAGGTAGTCCTTCTACTGACATCCATAATGTCATCAGCATATTGCTGTCGTATGGAT