Homologs in group_2393

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19215 FBDBKF_19215 97.9 Morganella morganii S1 rpsC 30S ribosomal protein S3
EHELCC_18960 EHELCC_18960 97.9 Morganella morganii S2 rpsC 30S ribosomal protein S3
NLDBIP_18975 NLDBIP_18975 97.9 Morganella morganii S4 rpsC 30S ribosomal protein S3
LHKJJB_18830 LHKJJB_18830 97.9 Morganella morganii S3 rpsC 30S ribosomal protein S3
HKOGLL_18565 HKOGLL_18565 97.9 Morganella morganii S5 rpsC 30S ribosomal protein S3
PMI_RS16180 PMI_RS16180 94.8 Proteus mirabilis HI4320 rpsC 30S ribosomal protein S3

Distribution of the homologs in the orthogroup group_2393

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2393

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6CZX6 3.16e-164 455 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DG68 8.76e-164 454 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3YWU5 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella sonnei (strain Ss046)
Q0SZY8 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella flexneri serotype 5b (strain 8401)
Q32B37 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW2 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella boydii serotype 4 (strain Sb227)
B2U2T2 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7V6 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7V7 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella typhi
B4TXD6 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella schwarzengrund (strain CVM19633)
B5BGY0 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi A (strain AKU_12601)
C0Q0B0 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi C (strain RKS4594)
A9MSZ2 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIV8 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT4 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella newport (strain SL254)
B4TKK9 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella heidelberg (strain SL476)
B5RH21 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R285 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella enteritidis PT4 (strain P125109)
B5FJK8 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella dublin (strain CT_02021853)
Q57J38 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella choleraesuis (strain SC-B67)
A9MN54 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7T9 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella agona (strain SL483)
B7LRT0 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WFC2 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Enterobacter sp. (strain 638)
Q1R612 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain UTI89 / UPEC)
B1LHC8 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain SMS-3-5 / SECEC)
B6I228 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain SE11)
B7NDT5 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7V3 6.04e-163 452 96 0 233 1 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain K12)
B1IPY5 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7V4 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE7 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGK2 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O1:K1 / APEC
A8A5B9 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O9:H4 (strain HS)
C4ZUG9 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M8 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O8 (strain IAI1)
B7N198 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O81 (strain ED1a)
B7NLN3 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN5 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7V5 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O157:H7
B7L4K3 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain 55989 / EAEC)
B7MCS9 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK38 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSK3 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQL0 6.04e-163 452 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MPI5 2.49e-162 451 95 0 233 3 rpsC Small ribosomal subunit protein uS3 Cronobacter sakazakii (strain ATCC BAA-894)
P59184 2e-161 448 95 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella flexneri
C5BGL9 2.46e-161 448 94 0 233 3 rpsC Small ribosomal subunit protein uS3 Edwardsiella ictaluri (strain 93-146)
A6TEW6 7.2e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNA0 7.2e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Klebsiella pneumoniae (strain 342)
B2VK58 7.2e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NQM8 9.48e-159 441 93 1 233 3 rpsC Small ribosomal subunit protein uS3 Sodalis glossinidius (strain morsitans)
Q7MYF7 9.62e-159 441 92 0 233 3 rpsC Small ribosomal subunit protein uS3 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JIW7 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664S7 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGZ8 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis (strain Pestoides F)
Q1CCV0 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R902 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA6 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis
B2K5M4 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FNM9 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS29 1.83e-158 441 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKJ1 8.5e-158 439 93 1 233 3 rpsC Small ribosomal subunit protein uS3 Serratia proteamaculans (strain 568)
Q1C2V3 1.66e-157 438 93 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis bv. Antiqua (strain Antiqua)
Q7VKD7 2.49e-154 430 90 1 234 3 rpsC Small ribosomal subunit protein uS3 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A3N364 7.65e-151 422 90 2 235 3 rpsC Small ribosomal subunit protein uS3 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7MPI2 3.17e-148 415 87 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio vulnificus (strain YJ016)
Q8DE45 3.17e-148 415 87 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio vulnificus (strain CMCP6)
C3LRQ2 8.97e-148 414 87 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ0 8.97e-148 414 87 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F543 8.97e-148 414 87 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9CL37 4.19e-146 410 86 2 235 3 rpsC Small ribosomal subunit protein uS3 Pasteurella multocida (strain Pm70)
P44372 4.89e-146 409 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHT6 5.39e-146 409 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain PittGG)
A5UDU1 5.39e-146 409 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain PittEE)
Q4QMB6 5.39e-146 409 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain 86-028NP)
A6VLJ4 2.22e-145 408 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A7N0I3 2.25e-145 407 86 1 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio campbellii (strain ATCC BAA-1116)
Q0I157 1.28e-144 406 86 2 235 3 rpsC Small ribosomal subunit protein uS3 Histophilus somni (strain 129Pt)
B7VLF1 1.64e-144 405 85 1 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio atlanticus (strain LGP32)
Q87T07 1.91e-144 405 85 1 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q65QW1 2.7e-144 405 86 2 235 3 rpsC Small ribosomal subunit protein uS3 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B5FG15 2.96e-144 405 86 0 229 3 rpsC Small ribosomal subunit protein uS3 Aliivibrio fischeri (strain MJ11)
Q5E8A9 2.96e-144 405 86 0 229 3 rpsC Small ribosomal subunit protein uS3 Aliivibrio fischeri (strain ATCC 700601 / ES114)
P55827 3.63e-144 405 85 2 235 3 rpsC Small ribosomal subunit protein uS3 Aggregatibacter actinomycetemcomitans
B6EPT1 1.22e-142 401 84 0 229 3 rpsC Small ribosomal subunit protein uS3 Aliivibrio salmonicida (strain LFI1238)
B8D843 9.69e-142 399 82 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57585 9.69e-142 399 82 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U1 1.42e-141 398 82 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q6LVB0 1.73e-141 398 83 1 233 3 rpsC Small ribosomal subunit protein uS3 Photobacterium profundum (strain SS9)
Q8K956 2.02e-140 395 82 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A0KF27 3.69e-139 392 89 0 211 3 rpsC Small ribosomal subunit protein uS3 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4ST00 6.09e-138 389 89 0 211 3 rpsC Small ribosomal subunit protein uS3 Aeromonas salmonicida (strain A449)
Q1LTD2 4.69e-137 387 80 0 233 3 rpsC Small ribosomal subunit protein uS3 Baumannia cicadellinicola subsp. Homalodisca coagulata
C4K7B2 4.59e-136 384 82 1 232 3 rpsC Small ribosomal subunit protein uS3 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P46172 1.62e-135 382 93 1 206 3 rpsC Small ribosomal subunit protein uS3 (Fragment) Buchnera aphidicola subsp. Acyrthosiphon kondoi
Q5QXY3 4.21e-134 379 79 1 229 3 rpsC Small ribosomal subunit protein uS3 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q15YN3 7.91e-134 379 80 1 229 3 rpsC Small ribosomal subunit protein uS3 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P59447 1.77e-132 375 77 1 235 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q3IF19 7.08e-130 369 81 0 218 3 rpsC Small ribosomal subunit protein uS3 Pseudoalteromonas translucida (strain TAC 125)
A1T0D6 9.66e-130 368 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1S224 2.62e-129 367 77 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3Q988 2.85e-129 367 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0I099 4.84e-129 366 77 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain MR-7)
Q0HNT1 4.84e-129 366 77 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain MR-4)
A0KRN0 4.84e-129 366 77 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain ANA-3)
P59183 4.84e-129 366 77 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q12SV3 1.24e-128 365 77 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q487Z9 4.79e-128 364 78 1 227 3 rpsC Small ribosomal subunit protein uS3 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1REC0 7.49e-128 363 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain W3-18-1)
A4YBX7 7.49e-128 363 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KWA8 1.27e-127 363 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS195)
A6WHT4 1.27e-127 363 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS185)
A3DA66 1.27e-127 363 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ9 1.27e-127 363 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS223)
Q089P8 2e-127 362 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella frigidimarina (strain NCIMB 400)
Q493K2 1.28e-126 360 79 0 209 3 rpsC Small ribosomal subunit protein uS3 Blochmanniella pennsylvanica (strain BPEN)
Q057B0 4.32e-126 359 74 1 235 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q8D206 7.56e-125 356 74 1 233 3 rpsC Small ribosomal subunit protein uS3 Wigglesworthia glossinidia brevipalpis
A1TYK3 2.38e-116 334 74 0 214 3 rpsC Small ribosomal subunit protein uS3 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9HWE1 2.44e-116 334 76 0 210 1 rpsC Small ribosomal subunit protein uS3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T74 2.44e-116 334 76 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6UZJ4 2.44e-116 334 76 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas aeruginosa (strain PA7)
A4VHN6 2.35e-115 332 75 0 210 3 rpsC Small ribosomal subunit protein uS3 Stutzerimonas stutzeri (strain A1501)
Q88QM9 1.06e-114 330 75 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXQ3 1.06e-114 330 75 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q7VQE2 1.36e-114 330 76 0 208 3 rpsC Small ribosomal subunit protein uS3 Blochmanniella floridana
Q1R0G9 1.38e-114 330 68 0 232 3 rpsC Small ribosomal subunit protein uS3 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q21M51 1.54e-114 329 72 0 219 3 rpsC Small ribosomal subunit protein uS3 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1IFW0 2.89e-114 329 75 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas entomophila (strain L48)
A4XZ84 3.89e-114 328 71 3 231 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas mendocina (strain ymp)
Q2S918 1.13e-113 327 73 0 214 3 rpsC Small ribosomal subunit protein uS3 Hahella chejuensis (strain KCTC 2396)
Q4K539 5.81e-113 325 74 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZMQ0 7.4e-113 325 74 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas syringae pv. syringae (strain B728a)
Q889W5 7.4e-113 325 74 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K5Z4 7.4e-113 325 74 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas fluorescens (strain Pf0-1)
Q48D42 7.4e-113 325 74 0 210 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0VSJ7 1.8e-112 324 68 0 229 3 rpsC Small ribosomal subunit protein uS3 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q6F7R8 2.62e-112 325 68 1 232 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8PNR9 3.49e-112 324 73 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas axonopodis pv. citri (strain 306)
Q3BWX7 6.37e-112 323 73 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0V6X4 2.12e-111 322 71 0 214 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain AYE)
A3M978 2.12e-111 322 71 0 214 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZA2 2.12e-111 322 71 0 214 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain ACICU)
B7GW08 2.12e-111 322 71 0 214 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain AB307-0294)
B0VQS4 2.27e-111 322 71 0 214 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain SDF)
B7IA33 2.5e-111 322 71 0 214 1 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain AB0057)
Q5GWU0 4.47e-111 321 73 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZZ1 4.47e-111 321 73 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PC44 2.81e-110 319 72 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URE5 2.81e-110 319 72 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas campestris pv. campestris (strain 8004)
A1KB21 1.72e-109 318 64 2 234 3 rpsC Small ribosomal subunit protein uS3 Azoarcus sp. (strain BH72)
Q1QDI0 1.11e-108 315 69 0 214 3 rpsC Small ribosomal subunit protein uS3 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUF0 2.66e-108 314 69 0 214 3 rpsC Small ribosomal subunit protein uS3 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q3J8S0 4.08e-108 313 69 0 208 3 rpsC Small ribosomal subunit protein uS3 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5WCJ6 1.16e-107 313 68 0 214 3 rpsC Small ribosomal subunit protein uS3 Psychrobacter sp. (strain PRwf-1)
Q1H4N1 1.47e-107 312 64 2 230 3 rpsC Small ribosomal subunit protein uS3 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q820R1 2.86e-107 311 67 0 209 3 rpsC Small ribosomal subunit protein uS3 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0ABG9 4.05e-107 311 70 0 208 3 rpsC Small ribosomal subunit protein uS3 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A0Q4I9 8.86e-107 310 65 2 233 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. novicida (strain U112)
A4IZS8 1.24e-106 309 69 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BNS1 1.24e-106 309 69 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5G4 1.24e-106 309 69 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T2 1.24e-106 309 69 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A1VIQ6 2.48e-106 311 63 2 238 3 rpsC Small ribosomal subunit protein uS3 Polaromonas naphthalenivorans (strain CJ2)
B2SDX9 4.28e-106 308 68 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. mediasiatica (strain FSC147)
C1DAS3 5.07e-106 308 63 1 231 3 rpsC Small ribosomal subunit protein uS3 Laribacter hongkongensis (strain HLHK9)
A1TJ13 5.27e-106 310 68 0 209 3 rpsC Small ribosomal subunit protein uS3 Paracidovorax citrulli (strain AAC00-1)
Q5P326 6.27e-106 310 61 2 234 3 rpsC Small ribosomal subunit protein uS3 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q21RW4 8.01e-106 310 69 0 209 3 rpsC Small ribosomal subunit protein uS3 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q0AII9 8.9e-106 307 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q47J97 9.63e-106 308 64 1 222 3 rpsC Small ribosomal subunit protein uS3 Dechloromonas aromatica (strain RCB)
A6X0C4 1e-105 307 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q5NHW2 1.29e-105 306 68 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JB4 1.29e-105 306 68 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. tularensis (strain FSC 198)
P59180 1.37e-105 307 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella suis biovar 1 (strain 1330)
A5VR00 1.37e-105 307 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q57CR4 1.37e-105 307 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella abortus biovar 1 (strain 9-941)
Q2YRA1 1.37e-105 307 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella abortus (strain 2308)
B2S673 1.37e-105 307 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella abortus (strain S19)
A1W2R3 1.53e-105 309 68 0 209 3 rpsC Small ribosomal subunit protein uS3 Acidovorax sp. (strain JS42)
Q8YHN4 2.05e-105 306 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJJ5 2.05e-105 306 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella melitensis biotype 2 (strain ATCC 23457)
Q7NQF8 2.8e-105 306 62 2 231 3 rpsC Small ribosomal subunit protein uS3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2YAZ1 2.95e-105 308 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B0CH26 3.74e-105 306 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q98N51 5.96e-105 306 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A1WHD1 9.14e-105 307 68 0 209 3 rpsC Small ribosomal subunit protein uS3 Verminephrobacter eiseniae (strain EF01-2)
Q11HQ8 1.27e-104 305 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Chelativorans sp. (strain BNC1)
A9M5P4 1.47e-104 305 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A4SUW7 1.47e-104 306 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q31IX6 1.99e-104 304 65 1 233 3 rpsC Small ribosomal subunit protein uS3 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2RQW6 6.37e-104 302 63 2 232 3 rpsC Small ribosomal subunit protein uS3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A4JAP6 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRV4 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia orbicola (strain AU 1054)
B1JU28 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia orbicola (strain MC0-3)
Q39KG1 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ40 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5C6 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N1 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia cenocepacia (strain HI2424)
B1YRD6 6.75e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia ambifaria (strain MC40-6)
Q13TH6 7.54e-104 304 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Paraburkholderia xenovorans (strain LB400)
Q12GW5 1.08e-103 305 63 2 236 3 rpsC Small ribosomal subunit protein uS3 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q92QG4 1.63e-103 302 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium meliloti (strain 1021)
B2T745 1.71e-103 303 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q8UE24 1.76e-103 302 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Agrobacterium fabrum (strain C58 / ATCC 33970)
C3MAY6 2.01e-103 301 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6U865 2.19e-103 301 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Sinorhizobium medicae (strain WSM419)
B2JI60 2.98e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A5EX93 3.33e-103 301 64 0 232 3 rpsC Small ribosomal subunit protein uS3 Dichelobacter nodosus (strain VCS1703A)
Q2SU33 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q17 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain K96243)
A3NEH3 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain 668)
Q3JMR9 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain 1710b)
A3P0A7 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain 1106a)
A1V897 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain SAVP1)
Q62GL1 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain ATCC 23344)
A2S7I2 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain NCTC 10229)
A3MRW0 3.63e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain NCTC 10247)
B6IRR2 4.2e-103 300 65 2 226 3 rpsC Small ribosomal subunit protein uS3 Rhodospirillum centenum (strain ATCC 51521 / SW)
A1WVB6 4.87e-103 300 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Halorhodospira halophila (strain DSM 244 / SL1)
B5ZYU1 6.18e-103 301 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2K9L0 7.14e-103 300 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWS7 7.14e-103 300 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium etli (strain CIAT 652)
A9ADJ9 8.07e-103 301 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia multivorans (strain ATCC 17616 / 249)
A9IIZ1 8.23e-103 301 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B2UEL3 9.17e-103 301 62 1 226 3 rpsC Small ribosomal subunit protein uS3 Ralstonia pickettii (strain 12J)
B9JDT4 9.66e-103 300 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q8XV18 1.35e-102 301 62 1 226 3 rpsC Small ribosomal subunit protein uS3 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2L2C0 2.06e-102 300 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella avium (strain 197N)
Q1MID5 2.45e-102 299 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7VTC7 2.86e-102 300 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2F0 2.86e-102 300 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRB9 2.86e-102 300 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1LI43 3.3e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q89J90 3.96e-102 298 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B3QBX4 4.73e-102 298 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain TIE-1)
A9NAN0 5.05e-102 298 67 0 207 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD25 5.05e-102 298 67 0 207 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain Dugway 5J108-111)
B6J257 5.05e-102 298 67 0 207 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain CbuG_Q212)
B6J5D8 5.05e-102 298 67 0 207 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain CbuK_Q154)
Q6N4U0 5.17e-102 298 65 1 226 1 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q605B8 5.31e-102 298 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q2IXQ4 5.68e-102 298 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain HaA2)
A5ELM1 5.71e-102 298 64 1 231 3 rpsC Small ribosomal subunit protein uS3 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q46WF0 6.72e-102 299 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q134T5 7.97e-102 297 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain BisB5)
Q07KM4 7.97e-102 297 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain BisA53)
Q2W2J7 8e-102 297 64 2 226 3 rpsC Small ribosomal subunit protein uS3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A4YSJ8 8.65e-102 298 64 1 231 3 rpsC Small ribosomal subunit protein uS3 Bradyrhizobium sp. (strain ORS 278)
Q211F4 1.66e-101 296 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain BisB18)
A8IAR2 2.08e-101 297 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A7IFY7 2.31e-101 297 63 1 227 3 rpsC Small ribosomal subunit protein uS3 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q3SLP3 2.91e-101 296 60 2 233 3 rpsC Small ribosomal subunit protein uS3 Thiobacillus denitrificans (strain ATCC 25259)
Q3SSW0 3.06e-101 296 63 1 227 3 rpsC Small ribosomal subunit protein uS3 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1USM0 3.36e-101 296 62 0 208 3 rpsC1 Small ribosomal subunit protein uS3 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A1B033 4.39e-101 296 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Paracoccus denitrificans (strain Pd 1222)
O85388 5.14e-101 295 66 0 207 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9IW20 1.16e-100 295 62 0 208 3 rpsC Small ribosomal subunit protein uS3 Bartonella tribocorum (strain CIP 105476 / IBS 506)
B3R7R7 1.37e-100 295 65 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K625 1.37e-100 295 65 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B1Y8I1 1.42e-100 296 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A2SLF1 1.48e-100 297 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1GK28 1.51e-100 295 62 1 228 3 rpsC Small ribosomal subunit protein uS3 Ruegeria sp. (strain TM1040)
Q1QN24 1.68e-100 294 63 1 226 3 rpsC Small ribosomal subunit protein uS3 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A1AVK6 8.71e-100 292 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Ruthia magnifica subsp. Calyptogena magnifica
B2IK68 2.04e-99 291 62 1 226 3 rpsC Small ribosomal subunit protein uS3 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q87E76 2.43e-99 291 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PE70 2.43e-99 291 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain 9a5c)
B2I8H5 2.43e-99 291 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain M23)
Q5LW56 2.91e-99 291 60 1 228 3 rpsC Small ribosomal subunit protein uS3 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B9KL97 2.92e-99 291 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5R6 2.92e-99 291 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGL7 2.92e-99 291 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B8ELF7 3.93e-99 291 63 1 226 3 rpsC Small ribosomal subunit protein uS3 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q6G2X1 4.32e-99 291 62 0 208 3 rpsC Small ribosomal subunit protein uS3 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A6T3J8 5.24e-99 292 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Janthinobacterium sp. (strain Marseille)
A4G9T2 9.35e-99 291 56 2 247 3 rpsC Small ribosomal subunit protein uS3 Herminiimonas arsenicoxydans
B0U5K5 1.59e-98 289 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain M12)
A4WVK2 2.05e-98 289 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q16AE5 2.46e-98 289 60 1 228 3 rpsC Small ribosomal subunit protein uS3 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q6FZC8 3.16e-98 288 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Bartonella quintana (strain Toulouse)
A1KRH9 4.92e-98 288 64 0 203 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66551 4.92e-98 288 64 0 203 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66550 4.92e-98 288 64 0 203 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3W0 4.92e-98 288 64 0 203 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup C (strain 053442)
A0L5X9 5.06e-98 287 64 1 208 3 rpsC Small ribosomal subunit protein uS3 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B6JET9 5.33e-98 288 61 1 231 3 rpsC Small ribosomal subunit protein uS3 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A8LM60 6.61e-98 288 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q1GPA5 8.46e-98 287 59 2 235 3 rpsC Small ribosomal subunit protein uS3 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B4RQY4 1.04e-97 287 63 0 203 3 rpsC Small ribosomal subunit protein uS3 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5T3 1.04e-97 287 63 0 203 3 rpsC Small ribosomal subunit protein uS3 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A7HWR7 1.09e-97 287 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A5CXL0 1.17e-97 287 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B4R8M3 1.21e-97 288 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Phenylobacterium zucineum (strain HLK1)
Q0BUP4 6.68e-97 285 62 2 226 3 rpsC Small ribosomal subunit protein uS3 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q28UV4 1.27e-96 285 58 2 240 3 rpsC Small ribosomal subunit protein uS3 Jannaschia sp. (strain CCS1)
B0T2C8 1.54e-96 285 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Caulobacter sp. (strain K31)
Q0ANQ6 4.01e-96 283 59 1 231 3 rpsC Small ribosomal subunit protein uS3 Maricaulis maris (strain MCS10)
Q2G8X4 6.19e-96 283 62 0 209 3 rpsC Small ribosomal subunit protein uS3 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B8H4E0 1.21e-95 282 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8U7 1.21e-95 282 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5FZV9 1.09e-94 279 60 2 226 3 rpsC Small ribosomal subunit protein uS3 Acidiphilium cryptum (strain JF-5)
A9H3P5 5.82e-94 277 60 2 226 3 rpsC Small ribosomal subunit protein uS3 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q5FTY9 7.25e-94 277 60 2 226 3 rpsC Small ribosomal subunit protein uS3 Gluconobacter oxydans (strain 621H)
Q5WZK6 7.98e-93 274 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila (strain Lens)
Q5NQ59 8.17e-93 275 57 1 225 3 rpsC Small ribosomal subunit protein uS3 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A5V5Z6 1.18e-92 274 58 0 209 3 rpsC Small ribosomal subunit protein uS3 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q5ZYN7 1.47e-92 273 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHQ8 1.47e-92 273 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila (strain Corby)
Q5X853 1.47e-92 273 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila (strain Paris)
Q0BYC0 4.12e-92 273 57 1 232 3 rpsC Small ribosomal subunit protein uS3 Hyphomonas neptunium (strain ATCC 15444)
A8ESU9 7.06e-92 272 58 0 232 3 rpsC Small ribosomal subunit protein uS3 Aliarcobacter butzleri (strain RM4018)
Q30TV8 3.14e-91 271 58 1 236 3 rpsC Small ribosomal subunit protein uS3 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B3E7U1 3.6e-91 270 60 1 210 3 rpsC Small ribosomal subunit protein uS3 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q2N9B7 5.68e-91 270 60 0 209 3 rpsC Small ribosomal subunit protein uS3 Erythrobacter litoralis (strain HTCC2594)
B1I1J4 6.13e-91 269 60 0 215 3 rpsC Small ribosomal subunit protein uS3 Desulforudis audaxviator (strain MP104C)
A4IJJ5 9.39e-91 269 62 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacillus thermodenitrificans (strain NG80-2)
C5D3S3 1.16e-90 269 62 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacillus sp. (strain WCH70)
Q5L417 1.68e-90 268 62 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacillus kaustophilus (strain HTA426)
A4J117 2.26e-90 268 59 0 208 3 rpsC Small ribosomal subunit protein uS3 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q3A9S2 2.81e-90 268 58 0 208 3 rpsC Small ribosomal subunit protein uS3 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B7GJ73 7.92e-90 266 62 1 208 3 rpsC Small ribosomal subunit protein uS3 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B9M6H2 1.55e-89 265 59 1 210 3 rpsC Small ribosomal subunit protein uS3 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A1ALU7 1.86e-89 265 58 1 210 3 rpsC Small ribosomal subunit protein uS3 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A4XLS4 2.56e-89 265 61 1 209 3 rpsC Small ribosomal subunit protein uS3 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A5GAX1 4.42e-89 264 59 1 210 3 rpsC Small ribosomal subunit protein uS3 Geotalea uraniireducens (strain Rf4)
Q7M8E0 9.08e-89 265 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A6QCQ4 1.19e-88 264 56 1 233 3 rpsC Small ribosomal subunit protein uS3 Sulfurovum sp. (strain NBC37-1)
Q3A6P1 1.29e-88 263 60 1 208 3 rpsC Small ribosomal subunit protein uS3 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8D0D0 1.45e-88 263 58 0 208 3 rpsC Small ribosomal subunit protein uS3 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q250M6 2.06e-88 263 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulfitobacterium hafniense (strain Y51)
Q5HS96 2.86e-88 263 55 1 233 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni (strain RM1221)
A1W1V4 2.86e-88 263 55 1 233 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PLX7 2.86e-88 263 55 1 233 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FP15 2.86e-88 263 55 1 233 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9ZJR9 2.92e-88 263 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain J99 / ATCC 700824)
B9MKH5 4.29e-88 262 59 1 214 3 rpsC Small ribosomal subunit protein uS3 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
P59182 4.76e-88 262 60 1 208 3 rpsC Small ribosomal subunit protein uS3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A5D5G1 4.77e-88 263 57 0 208 3 rpsC Small ribosomal subunit protein uS3 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q2RFQ3 5.76e-88 262 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q1D769 7.49e-88 261 59 1 210 3 rpsC Small ribosomal subunit protein uS3 Myxococcus xanthus (strain DK1622)
A6Q1I4 8.13e-88 262 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Nitratiruptor sp. (strain SB155-2)
B5EFQ6 8.86e-88 261 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6E4Q1 8.95e-88 261 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacter sp. (strain M21)
P21465 1.1e-87 261 58 1 208 1 rpsC Small ribosomal subunit protein uS3 Bacillus subtilis (strain 168)
A7H650 1.23e-87 261 55 1 233 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B5YG41 1.28e-87 261 61 1 210 3 rpsC Small ribosomal subunit protein uS3 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q17ZD2 1.41e-87 261 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter acinonychis (strain Sheeba)
Q1WS96 1.41e-87 261 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Ligilactobacillus salivarius (strain UCC118)
B2UV76 1.71e-87 261 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain Shi470)
Q1CRU7 1.71e-87 261 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain HPAG1)
B5Z8W1 1.71e-87 261 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain G27)
B8G1X2 1.72e-87 261 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q748Z4 1.88e-87 260 58 1 210 3 rpsC Small ribosomal subunit protein uS3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A7ZG06 2.09e-87 261 54 0 232 3 rpsC Small ribosomal subunit protein uS3 Campylobacter concisus (strain 13826)
B6JNF1 2.2e-87 261 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain P12)
B9KEE6 3.19e-87 260 54 1 233 3 rpsC Small ribosomal subunit protein uS3 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
C0Q9W7 4.84e-87 259 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q39Y00 6.2e-87 259 58 1 210 3 rpsC Small ribosomal subunit protein uS3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A7Z0P4 7.34e-87 259 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A7GK26 7.43e-87 259 60 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
P56010 7.66e-87 259 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain ATCC 700392 / 26695)
A3DJH8 9.29e-87 259 57 0 208 3 rpsC Small ribosomal subunit protein uS3 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2TII1 1.4e-86 258 57 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Eklund 17B / Type B)
Q5WLQ6 1.43e-86 258 57 0 208 3 rpsC Small ribosomal subunit protein uS3 Shouchella clausii (strain KSM-K16)
P23309 1.69e-86 258 60 1 208 1 rpsC Small ribosomal subunit protein uS3 Geobacillus stearothermophilus
A8F991 1.86e-86 258 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus pumilus (strain SAFR-032)
B2UYB6 2.06e-86 258 57 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Alaska E43 / Type E3)
Q65PA1 2.7e-86 258 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2LQ95 2.81e-86 258 59 1 215 3 rpsC Small ribosomal subunit protein uS3 Syntrophus aciditrophicus (strain SB)
A7H106 3.1e-86 258 54 0 232 3 rpsC Small ribosomal subunit protein uS3 Campylobacter curvus (strain 525.92)
A0ALW2 5.86e-86 257 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66548 5.86e-86 257 59 1 208 1 rpsC Small ribosomal subunit protein uS3 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WF2 5.86e-86 257 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Listeria monocytogenes serotype 4b (strain F2365)
P66549 5.86e-86 257 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A8ZV63 6.97e-86 256 60 2 210 3 rpsC Small ribosomal subunit protein uS3 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q9Z9K8 8.05e-86 256 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A5VLJ9 1.07e-85 256 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Limosilactobacillus reuteri (strain DSM 20016)
B4UBA5 1.5e-85 256 56 1 213 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter sp. (strain K)
B8J866 1.5e-85 256 56 1 213 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B1HMX4 1.55e-85 256 58 1 215 3 rpsC Small ribosomal subunit protein uS3 Lysinibacillus sphaericus (strain C3-41)
A0LIJ6 2.18e-85 255 60 1 208 3 rpsC Small ribosomal subunit protein uS3 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B1IGE8 2.71e-85 255 54 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Okra / Type B1)
Q2IJ82 2.71e-85 255 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q6AP65 2.98e-85 255 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q839F8 3.15e-85 255 59 1 208 1 rpsC Small ribosomal subunit protein uS3 Enterococcus faecalis (strain ATCC 700802 / V583)
Q4FLM4 3.85e-85 255 55 0 208 3 rpsC Small ribosomal subunit protein uS3 Pelagibacter ubique (strain HTCC1062)
C0ZII6 4.1e-85 254 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A7GJ68 6.29e-85 254 54 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I7K0 7.1e-85 254 54 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ63 7.1e-85 254 54 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain ATCC 19397 / Type A)
C1A6R1 7.32e-85 254 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A7HBM4 1.12e-84 254 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter sp. (strain Fw109-5)
B9L6M7 1.5e-84 254 54 3 237 3 rpsC Small ribosomal subunit protein uS3 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A8YXL1 1.88e-84 253 55 2 226 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus helveticus (strain DPC 4571)
B1KSL9 2.03e-84 253 54 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Loch Maree / Type A3)
C1FMU5 2.03e-84 253 54 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Kyoto / Type A2)
C1CP94 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA3 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain P1031)
C1CC12 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain JJA)
P0A4C4 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS46 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain CGSP14)
P0A4C3 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG3 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8K4 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAL8 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain 70585)
B5E6G1 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MN0 4.02e-84 252 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A0RM17 5.03e-84 252 55 1 232 3 rpsC Small ribosomal subunit protein uS3 Campylobacter fetus subsp. fetus (strain 82-40)
Q03IF7 5.96e-84 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
P59186 6.94e-84 251 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1MPQ7 7.08e-84 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Lawsonia intracellularis (strain PHE/MN1-00)
C3KVP5 7.19e-84 251 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain 657 / Type Ba4)
Q5M2B9 7.91e-84 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXR7 7.91e-84 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus thermophilus (strain CNRZ 1066)
C0MCB6 8e-84 251 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U506 8e-84 251 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8D5 8e-84 251 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus equi subsp. equi (strain 4047)
A4VSG0 9.63e-84 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus suis (strain 05ZYH33)
A4VYP9 9.63e-84 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus suis (strain 98HAH33)
A8AZL9 9.63e-84 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q034Y9 1.16e-83 251 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B1YGV6 1.2e-83 251 57 2 209 3 rpsC Small ribosomal subunit protein uS3 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q5FM84 1.27e-83 251 54 2 226 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
C4KZP0 1.58e-83 251 57 2 209 3 rpsC Small ribosomal subunit protein uS3 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A3CK69 1.74e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus sanguinis (strain SK36)
Q7VGD8 1.85e-83 251 57 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q74L83 2.82e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
P0DE91 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VU3 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC20 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J908 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ56 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP11 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE52 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66557 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEC9 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE90 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66555 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M1
P66559 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66558 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3W3 3.14e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B1GZ89 3.22e-83 250 56 2 218 3 rpsC Small ribosomal subunit protein uS3 Endomicrobium trichonymphae
B9DSV6 3.31e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03EC2 3.32e-83 250 55 1 208 3 rpsC Small ribosomal subunit protein uS3 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B8FES9 3.82e-83 249 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Desulfatibacillum aliphaticivorans
Q046B9 5.08e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A8MLE6 9.61e-83 249 56 1 209 3 rpsC Small ribosomal subunit protein uS3 Alkaliphilus oremlandii (strain OhILAs)
A6LPR7 1.4e-82 248 55 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q5Z1V7 1.84e-82 249 53 2 222 3 rpsC Small ribosomal subunit protein uS3 Nocardia farcinica (strain IFM 10152)
Q2S3Q8 2.4e-82 248 51 2 237 3 rpsC Small ribosomal subunit protein uS3 Salinibacter ruber (strain DSM 13855 / M31)
B2A4E5 2.62e-82 248 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q88XY0 2.67e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A7HZL2 3.06e-82 248 55 1 221 3 rpsC Small ribosomal subunit protein uS3 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B8G6R9 3.16e-82 248 51 0 230 3 rpsC Small ribosomal subunit protein uS3 Chloroflexus aggregans (strain MD-66 / DSM 9485)
C4LL46 3.76e-82 248 57 2 211 3 rpsC Small ribosomal subunit protein uS3 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q11QB8 3.84e-82 248 56 1 209 3 rpsC Small ribosomal subunit protein uS3 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q30Z48 4.03e-82 247 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5PA64 4.65e-82 246 52 1 206 3 rpsC Small ribosomal subunit protein uS3 Anaplasma marginale (strain St. Maries)
B9KJ64 4.65e-82 246 52 1 206 3 rpsC Small ribosomal subunit protein uS3 Anaplasma marginale (strain Florida)
P66554 5.14e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain MW2)
Q6G777 5.14e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain MSSA476)
Q6GEI9 5.14e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain MRSA252)
P66553 5.14e-82 247 56 1 208 1 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain N315)
P66552 5.14e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ86 5.14e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain Newman)
Q2YYQ2 5.14e-82 247 56 1 208 1 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FW12 5.14e-82 247 56 1 208 1 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEP5 5.14e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain USA300)
A7X5F5 5.14e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B2UMT3 6.93e-82 247 56 1 206 3 rpsC Small ribosomal subunit protein uS3 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q01W98 7.45e-82 251 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Solibacter usitatus (strain Ellin6076)
Q0SQF0 7.55e-82 246 54 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium perfringens (strain SM101 / Type A)
Q8XHS9 7.55e-82 246 54 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium perfringens (strain 13 / Type A)
Q0TMQ2 7.55e-82 246 54 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q4L8A8 7.96e-82 246 55 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus haemolyticus (strain JCSC1435)
Q97EI4 8.6e-82 246 55 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5HDW4 8.97e-82 246 55 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain COL)
Q4JT53 9.62e-82 247 55 2 211 3 rpsC Small ribosomal subunit protein uS3 Corynebacterium jeikeium (strain K411)
Q1ISB6 1e-81 246 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Koribacter versatilis (strain Ellin345)
Q03PW3 1.5e-81 246 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q6HPQ2 1.58e-81 246 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H84 1.58e-81 246 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cereus (strain ZK / E33L)
Q81J36 1.58e-81 246 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q73F90 1.58e-81 246 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81VS4 1.58e-81 246 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus anthracis
A0R8I6 1.58e-81 246 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus thuringiensis (strain Al Hakam)
Q8NT01 1.68e-81 246 54 2 217 3 rpsC Small ribosomal subunit protein uS3 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBI7 1.68e-81 246 54 2 217 3 rpsC Small ribosomal subunit protein uS3 Corynebacterium glutamicum (strain R)
B9LJD8 2e-81 246 55 0 213 3 rpsC Small ribosomal subunit protein uS3 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH72 2e-81 246 55 0 213 3 rpsC Small ribosomal subunit protein uS3 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B1VEU2 2.23e-81 246 56 2 211 3 rpsC Small ribosomal subunit protein uS3 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q6NJC9 2.43e-81 246 56 2 211 3 rpsC Small ribosomal subunit protein uS3 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A5USI3 2.79e-81 246 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Roseiflexus sp. (strain RS-1)
B8IYH8 3.18e-81 244 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q2GL53 3.36e-81 244 51 1 206 3 rpsC Small ribosomal subunit protein uS3 Anaplasma phagocytophilum (strain HZ)
A6TWH6 3.49e-81 245 50 1 231 3 rpsC Small ribosomal subunit protein uS3 Alkaliphilus metalliredigens (strain QYMF)
B0RZU6 3.81e-81 245 54 0 216 3 rpsC Small ribosomal subunit protein uS3 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q5HAS8 4.71e-81 244 55 1 206 3 rpsC Small ribosomal subunit protein uS3 Ehrlichia ruminantium (strain Welgevonden)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18950
Feature type CDS
Gene rpsC
Product 30S ribosomal protein S3
Location 10301 - 11002 (strand: 1)
Length 702 (nucleotides) / 233 (amino acids)

Contig

Accession term accessions NZ_VXKB01000011 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 30728 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2393
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00189 Ribosomal protein S3, C-terminal domain
PF07650 KH domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0092 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S3

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02982 small subunit ribosomal protein S3 Ribosome -

Protein Sequence

MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDGDFKVRKYLTKELEKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKKVSDIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAQTTYGVIGVKVWIFKGEILGGMAAVELAEKPSAQPKKQQRKGRK

Flanking regions ( +/- flanking 50bp)

AGCCACATTACTGTGGTTGTGTCCGATCGCTGAGACTCTGGAGACTAGCAATGGGTCAGAAAGTACATCCAAATGGTATTCGCCTGGGTATTGTTAAACCTTGGAACTCTACTTGGTTTGCGAACACCAAAGAATTCGCTGACAATCTGGACGGCGATTTCAAAGTACGTAAGTACTTAACAAAAGAACTGGAAAAAGCGTCAGTATCACGCATCGTTATCGAACGTCCGGCTAAAAGCATTCGTGTGACTATTCACACTGCCCGCCCCGGTATCGTTATCGGTAAGAAAGGCGAAGACGTCGAGAAACTGCGTAAAAAAGTTTCAGACATCGCTGGCGTACCTGCGCAAATTAATATTGCCGAAGTACGTAAACCTGAGCTTGACGCAAAATTAGTTGCTGACAGTATCACTTCACAGCTGGAACGTCGTGTTATGTTCCGTCGTGCTATGAAGCGTGCTGTACAGAACGCAATGCGTTTAGGCGCTAAAGGTATTAAAGTGGAAGTAAGCGGTCGTTTAGGCGGCGCTGAAATCGCTCGTACTGAGTGGTATCGTGAAGGCCGTGTGCCTTTGCATACCCTGCGTGCAGACATCGATTACAACACATCTGAAGCACAAACTACTTATGGTGTGATCGGCGTTAAAGTGTGGATCTTCAAAGGCGAGATCCTGGGTGGCATGGCTGCAGTTGAACTGGCGGAAAAACCGTCTGCTCAACCTAAAAAACAGCAGCGTAAAGGCCGTAAGTAAGGAGAGTCGCTGAATGTTACAACCAAAGCGTACAAAATTCCGTAAGATGC