Homologs in group_2426

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19215 FBDBKF_19215 100.0 Morganella morganii S1 rpsC 30S ribosomal protein S3
EHELCC_18960 EHELCC_18960 100.0 Morganella morganii S2 rpsC 30S ribosomal protein S3
NLDBIP_18975 NLDBIP_18975 100.0 Morganella morganii S4 rpsC 30S ribosomal protein S3
HKOGLL_18565 HKOGLL_18565 100.0 Morganella morganii S5 rpsC 30S ribosomal protein S3
F4V73_RS18950 F4V73_RS18950 97.9 Morganella psychrotolerans rpsC 30S ribosomal protein S3
PMI_RS16180 PMI_RS16180 95.7 Proteus mirabilis HI4320 rpsC 30S ribosomal protein S3

Distribution of the homologs in the orthogroup group_2426

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2426

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C6DG68 1.6e-165 459 97 0 233 3 rpsC Small ribosomal subunit protein uS3 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZX6 3.68e-165 457 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3YWU5 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella sonnei (strain Ss046)
Q0SZY8 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella flexneri serotype 5b (strain 8401)
Q32B37 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW2 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella boydii serotype 4 (strain Sb227)
B2U2T2 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7V6 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7V7 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella typhi
B4TXD6 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella schwarzengrund (strain CVM19633)
B5BGY0 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi A (strain AKU_12601)
C0Q0B0 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi C (strain RKS4594)
A9MSZ2 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIV8 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUT4 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella newport (strain SL254)
B4TKK9 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella heidelberg (strain SL476)
B5RH21 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R285 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella enteritidis PT4 (strain P125109)
B5FJK8 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella dublin (strain CT_02021853)
Q57J38 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella choleraesuis (strain SC-B67)
A9MN54 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7T9 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Salmonella agona (strain SL483)
B7LRT0 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WFC2 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Enterobacter sp. (strain 638)
Q1R612 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain UTI89 / UPEC)
B1LHC8 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain SMS-3-5 / SECEC)
B6I228 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain SE11)
B7NDT5 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7V3 1.02e-164 456 96 0 233 1 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain K12)
B1IPY5 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7V4 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE7 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGK2 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O1:K1 / APEC
A8A5B9 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O9:H4 (strain HS)
C4ZUG9 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M8 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O8 (strain IAI1)
B7N198 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O81 (strain ED1a)
B7NLN3 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTN5 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7V5 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O157:H7
B7L4K3 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli (strain 55989 / EAEC)
B7MCS9 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK38 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSK3 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQL0 1.02e-164 456 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MPI5 5.12e-164 455 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Cronobacter sakazakii (strain ATCC BAA-894)
P59184 3.03e-163 453 96 0 233 3 rpsC Small ribosomal subunit protein uS3 Shigella flexneri
C5BGL9 3.77e-163 452 95 0 233 3 rpsC Small ribosomal subunit protein uS3 Edwardsiella ictaluri (strain 93-146)
A6TEW6 1.03e-161 449 96 1 233 3 rpsC Small ribosomal subunit protein uS3 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNA0 1.03e-161 449 96 1 233 3 rpsC Small ribosomal subunit protein uS3 Klebsiella pneumoniae (strain 342)
B2VK58 1.03e-161 449 96 1 233 3 rpsC Small ribosomal subunit protein uS3 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7MYF7 1.11e-160 446 93 0 233 3 rpsC Small ribosomal subunit protein uS3 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NQM8 1.27e-160 446 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Sodalis glossinidius (strain morsitans)
B1JIW7 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664S7 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGZ8 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis (strain Pestoides F)
Q1CCV0 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R902 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA6 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis
B2K5M4 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FNM9 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS29 6.67e-160 444 95 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKJ1 1.35e-159 444 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Serratia proteamaculans (strain 568)
Q1C2V3 4.6e-159 442 94 1 233 3 rpsC Small ribosomal subunit protein uS3 Yersinia pestis bv. Antiqua (strain Antiqua)
Q7VKD7 1.45e-153 428 90 1 234 3 rpsC Small ribosomal subunit protein uS3 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A3N364 1.74e-150 421 89 2 235 3 rpsC Small ribosomal subunit protein uS3 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7MPI2 1.69e-147 413 86 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio vulnificus (strain YJ016)
Q8DE45 1.69e-147 413 86 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio vulnificus (strain CMCP6)
C3LRQ2 5.3e-147 412 86 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ0 5.3e-147 412 86 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F543 5.3e-147 412 86 0 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P44372 2.37e-146 410 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CL37 3.02e-146 410 86 2 235 3 rpsC Small ribosomal subunit protein uS3 Pasteurella multocida (strain Pm70)
A5UHT6 3.15e-146 410 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain PittGG)
A5UDU1 3.15e-146 410 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain PittEE)
Q4QMB6 3.15e-146 410 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Haemophilus influenzae (strain 86-028NP)
Q65QW1 6.22e-146 409 87 2 235 3 rpsC Small ribosomal subunit protein uS3 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VLJ4 2.86e-145 407 86 2 235 3 rpsC Small ribosomal subunit protein uS3 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0I157 9.64e-145 406 86 2 235 3 rpsC Small ribosomal subunit protein uS3 Histophilus somni (strain 129Pt)
A7N0I3 4.9e-144 404 85 1 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio campbellii (strain ATCC BAA-1116)
P55827 1.01e-143 404 85 2 235 3 rpsC Small ribosomal subunit protein uS3 Aggregatibacter actinomycetemcomitans
B5FG15 1.87e-143 403 85 0 229 3 rpsC Small ribosomal subunit protein uS3 Aliivibrio fischeri (strain MJ11)
Q5E8A9 1.87e-143 403 85 0 229 3 rpsC Small ribosomal subunit protein uS3 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87T07 3.06e-143 402 84 1 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VLF1 3.09e-143 402 84 1 233 3 rpsC Small ribosomal subunit protein uS3 Vibrio atlanticus (strain LGP32)
B8D843 1.62e-142 400 82 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57585 1.62e-142 400 82 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U1 2.75e-142 400 82 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B6EPT1 9.99e-142 399 84 0 229 3 rpsC Small ribosomal subunit protein uS3 Aliivibrio salmonicida (strain LFI1238)
Q8K956 1.06e-140 396 81 0 233 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q6LVB0 7.05e-140 394 82 1 233 3 rpsC Small ribosomal subunit protein uS3 Photobacterium profundum (strain SS9)
A0KF27 2.11e-139 393 89 0 211 3 rpsC Small ribosomal subunit protein uS3 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4ST00 2.74e-138 390 89 0 211 3 rpsC Small ribosomal subunit protein uS3 Aeromonas salmonicida (strain A449)
Q1LTD2 3.9e-138 389 81 0 233 3 rpsC Small ribosomal subunit protein uS3 Baumannia cicadellinicola subsp. Homalodisca coagulata
P46172 3.93e-138 388 95 1 206 3 rpsC Small ribosomal subunit protein uS3 (Fragment) Buchnera aphidicola subsp. Acyrthosiphon kondoi
C4K7B2 2.83e-135 382 82 1 232 3 rpsC Small ribosomal subunit protein uS3 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q5QXY3 2.28e-134 380 79 1 229 3 rpsC Small ribosomal subunit protein uS3 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P59447 7.71e-134 379 78 1 235 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q15YN3 2.73e-133 377 80 2 229 3 rpsC Small ribosomal subunit protein uS3 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q487Z9 2.66e-130 369 79 1 227 3 rpsC Small ribosomal subunit protein uS3 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1S224 6.37e-130 369 77 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1T0D6 9.04e-130 368 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0I099 1.11e-129 368 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain MR-7)
Q0HNT1 1.11e-129 368 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain MR-4)
A0KRN0 1.11e-129 368 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain ANA-3)
P59183 1.11e-129 368 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q12SV3 2.76e-129 367 77 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q3IF19 3.51e-129 367 80 0 218 3 rpsC Small ribosomal subunit protein uS3 Pseudoalteromonas translucida (strain TAC 125)
A3Q988 4.72e-129 366 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1REC0 1.86e-128 365 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella sp. (strain W3-18-1)
A4YBX7 1.86e-128 365 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KWA8 2.34e-128 365 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS195)
A6WHT4 2.34e-128 365 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS185)
A3DA66 2.34e-128 365 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ9 2.34e-128 365 76 1 232 3 rpsC Small ribosomal subunit protein uS3 Shewanella baltica (strain OS223)
Q089P8 2.81e-127 362 76 1 229 3 rpsC Small ribosomal subunit protein uS3 Shewanella frigidimarina (strain NCIMB 400)
Q057B0 2.39e-126 360 74 1 235 3 rpsC Small ribosomal subunit protein uS3 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q493K2 3.56e-126 359 79 0 209 3 rpsC Small ribosomal subunit protein uS3 Blochmanniella pennsylvanica (strain BPEN)
Q8D206 8.27e-126 358 74 1 232 3 rpsC Small ribosomal subunit protein uS3 Wigglesworthia glossinidia brevipalpis
A1TYK3 1.02e-117 337 75 0 214 3 rpsC Small ribosomal subunit protein uS3 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1R0G9 1.54e-116 335 69 0 232 3 rpsC Small ribosomal subunit protein uS3 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9HWE1 3.78e-116 333 72 1 227 1 rpsC Small ribosomal subunit protein uS3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T74 3.78e-116 333 72 1 227 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6UZJ4 3.78e-116 333 72 1 227 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas aeruginosa (strain PA7)
Q2S918 1.12e-115 332 73 0 214 3 rpsC Small ribosomal subunit protein uS3 Hahella chejuensis (strain KCTC 2396)
A4VHN6 1.17e-115 332 71 0 225 3 rpsC Small ribosomal subunit protein uS3 Stutzerimonas stutzeri (strain A1501)
Q88QM9 2.41e-115 332 71 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXQ3 2.41e-115 332 71 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IFW0 8.48e-115 330 71 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas entomophila (strain L48)
A4XZ84 1.33e-114 330 70 1 230 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas mendocina (strain ymp)
Q21M51 4.65e-114 328 72 0 219 3 rpsC Small ribosomal subunit protein uS3 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q7VQE2 2.04e-113 327 75 0 208 3 rpsC Small ribosomal subunit protein uS3 Blochmanniella floridana
Q4ZMQ0 3.25e-113 326 70 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas syringae pv. syringae (strain B728a)
Q889W5 3.25e-113 326 70 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K5Z4 3.25e-113 326 70 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas fluorescens (strain Pf0-1)
Q48D42 3.25e-113 326 70 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4K539 3.36e-113 326 70 0 225 3 rpsC Small ribosomal subunit protein uS3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6F7R8 1.53e-112 325 68 1 232 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0VSJ7 1.55e-112 325 68 0 229 3 rpsC Small ribosomal subunit protein uS3 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q8PNR9 1.56e-111 322 73 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas axonopodis pv. citri (strain 306)
Q3BWX7 2.89e-111 322 73 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0VQS4 6.27e-111 321 68 0 226 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain SDF)
B0V6X4 6.92e-111 321 68 0 226 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain AYE)
A3M978 6.92e-111 321 68 0 226 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZA2 6.92e-111 321 68 0 226 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain ACICU)
B7GW08 6.92e-111 321 68 0 226 3 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain AB307-0294)
B7IA33 1.06e-110 321 68 0 226 1 rpsC Small ribosomal subunit protein uS3 Acinetobacter baumannii (strain AB0057)
Q5GWU0 3.04e-110 319 72 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZZ1 3.04e-110 319 72 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1KB21 6.77e-110 319 64 2 234 3 rpsC Small ribosomal subunit protein uS3 Azoarcus sp. (strain BH72)
Q8PC44 8.97e-110 318 71 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URE5 8.97e-110 318 71 0 208 3 rpsC Small ribosomal subunit protein uS3 Xanthomonas campestris pv. campestris (strain 8004)
Q820R1 7.3e-109 315 67 0 209 3 rpsC Small ribosomal subunit protein uS3 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1H4N1 9.12e-109 315 63 1 233 3 rpsC Small ribosomal subunit protein uS3 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A0Q4I9 1.1e-108 315 67 0 223 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. novicida (strain U112)
A4IZS8 1.66e-108 314 67 0 223 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BNS1 1.66e-108 314 67 0 223 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5G4 1.66e-108 314 67 0 223 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T2 1.66e-108 314 67 0 223 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q1QDI0 4.5e-108 313 69 0 214 3 rpsC Small ribosomal subunit protein uS3 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B2SDX9 5.61e-108 313 66 0 223 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q4FUF0 1.37e-107 312 68 0 214 3 rpsC Small ribosomal subunit protein uS3 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q3J8S0 3.13e-107 311 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0AII9 3.44e-107 310 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1VIQ6 3.83e-107 313 63 1 238 3 rpsC Small ribosomal subunit protein uS3 Polaromonas naphthalenivorans (strain CJ2)
Q0ABG9 4.77e-107 310 69 0 208 3 rpsC Small ribosomal subunit protein uS3 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A5WCJ6 5.04e-107 311 67 0 219 3 rpsC Small ribosomal subunit protein uS3 Psychrobacter sp. (strain PRwf-1)
Q5NHW2 6.44e-107 310 69 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JB4 6.44e-107 310 69 0 213 3 rpsC Small ribosomal subunit protein uS3 Francisella tularensis subsp. tularensis (strain FSC 198)
C1DAS3 6.7e-107 310 63 1 231 3 rpsC Small ribosomal subunit protein uS3 Laribacter hongkongensis (strain HLHK9)
A6X0C4 1.58e-106 310 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P59180 2.29e-106 309 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella suis biovar 1 (strain 1330)
A5VR00 2.29e-106 309 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q57CR4 2.29e-106 309 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella abortus biovar 1 (strain 9-941)
Q2YRA1 2.29e-106 309 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella abortus (strain 2308)
B2S673 2.29e-106 309 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella abortus (strain S19)
Q5P326 2.91e-106 310 61 2 234 3 rpsC Small ribosomal subunit protein uS3 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8YHN4 3.67e-106 308 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJJ5 3.67e-106 308 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella melitensis biotype 2 (strain ATCC 23457)
B0CH26 5.15e-106 308 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q98N51 7.62e-106 308 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4SUW7 8.86e-106 309 67 0 209 3 rpsC Small ribosomal subunit protein uS3 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q11HQ8 1.11e-105 307 62 1 232 3 rpsC Small ribosomal subunit protein uS3 Chelativorans sp. (strain BNC1)
Q47J97 1.88e-105 308 63 1 223 3 rpsC Small ribosomal subunit protein uS3 Dechloromonas aromatica (strain RCB)
Q7NQF8 1.99e-105 306 62 1 231 3 rpsC Small ribosomal subunit protein uS3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9M5P4 2.55e-105 306 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YAZ1 3.01e-105 308 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q12GW5 3.04e-105 309 63 2 236 3 rpsC Small ribosomal subunit protein uS3 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1TJ13 3.89e-105 308 68 0 209 3 rpsC Small ribosomal subunit protein uS3 Paracidovorax citrulli (strain AAC00-1)
Q2RQW6 4.32e-105 305 63 2 232 3 rpsC Small ribosomal subunit protein uS3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q21RW4 4.76e-105 308 68 0 209 3 rpsC Small ribosomal subunit protein uS3 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B6IRR2 6.08e-105 305 66 2 226 3 rpsC Small ribosomal subunit protein uS3 Rhodospirillum centenum (strain ATCC 51521 / SW)
A1W2R3 9.1e-105 307 68 0 209 3 rpsC Small ribosomal subunit protein uS3 Acidovorax sp. (strain JS42)
Q31IX6 1.37e-104 304 65 1 233 3 rpsC Small ribosomal subunit protein uS3 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q92QG4 2.04e-104 304 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium meliloti (strain 1021)
Q8UE24 2.13e-104 304 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Agrobacterium fabrum (strain C58 / ATCC 33970)
A9NAN0 2.17e-104 304 63 1 230 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD25 2.17e-104 304 63 1 230 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain Dugway 5J108-111)
B6J257 2.17e-104 304 63 1 230 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain CbuG_Q212)
B6J5D8 2.17e-104 304 63 1 230 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain CbuK_Q154)
C3MAY6 2.48e-104 304 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6U865 2.71e-104 304 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Sinorhizobium medicae (strain WSM419)
A1WHD1 4e-104 306 67 0 209 3 rpsC Small ribosomal subunit protein uS3 Verminephrobacter eiseniae (strain EF01-2)
B5ZYU1 1.03e-103 303 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2K9L0 1.15e-103 303 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWS7 1.15e-103 303 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium etli (strain CIAT 652)
B9JDT4 1.59e-103 302 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q605B8 1.82e-103 301 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q2W2J7 2.26e-103 301 65 2 226 3 rpsC Small ribosomal subunit protein uS3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
O85388 2.57e-103 301 63 1 230 3 rpsC Small ribosomal subunit protein uS3 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A4JAP6 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRV4 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia orbicola (strain AU 1054)
B1JU28 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia orbicola (strain MC0-3)
Q39KG1 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ40 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5C6 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3N1 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia cenocepacia (strain HI2424)
B1YRD6 3.12e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia ambifaria (strain MC40-6)
Q89J90 3.34e-103 301 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q13TH6 3.45e-103 302 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Paraburkholderia xenovorans (strain LB400)
Q2IXQ4 3.64e-103 301 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain HaA2)
A5ELM1 3.87e-103 301 64 1 231 3 rpsC Small ribosomal subunit protein uS3 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YSJ8 5.37e-103 301 64 1 231 3 rpsC Small ribosomal subunit protein uS3 Bradyrhizobium sp. (strain ORS 278)
Q1MID5 5.73e-103 301 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q134T5 5.89e-103 300 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain BisB5)
Q07KM4 5.89e-103 300 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain BisA53)
B3QBX4 6.39e-103 300 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain TIE-1)
A5EX93 6.5e-103 300 63 0 232 3 rpsC Small ribosomal subunit protein uS3 Dichelobacter nodosus (strain VCS1703A)
Q6N4U0 7.21e-103 300 65 1 226 1 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B2T745 9.53e-103 301 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1WVB6 1.26e-102 299 68 0 208 3 rpsC Small ribosomal subunit protein uS3 Halorhodospira halophila (strain DSM 244 / SL1)
Q211F4 1.3e-102 300 65 1 226 3 rpsC Small ribosomal subunit protein uS3 Rhodopseudomonas palustris (strain BisB18)
Q3SSW0 1.34e-102 299 64 1 227 3 rpsC Small ribosomal subunit protein uS3 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B2JI60 1.77e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A7IFY7 1.89e-102 300 63 1 227 3 rpsC Small ribosomal subunit protein uS3 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A9IIZ1 2.38e-102 300 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2SU33 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q17 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain K96243)
A3NEH3 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain 668)
Q3JMR9 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain 1710b)
A3P0A7 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia pseudomallei (strain 1106a)
A1V897 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain SAVP1)
Q62GL1 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain ATCC 23344)
A2S7I2 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain NCTC 10229)
A3MRW0 2.49e-102 300 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia mallei (strain NCTC 10247)
A1USM0 2.65e-102 299 62 0 208 3 rpsC1 Small ribosomal subunit protein uS3 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A8IAR2 3.21e-102 299 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A9ADJ9 4.44e-102 299 66 0 209 3 rpsC Small ribosomal subunit protein uS3 Burkholderia multivorans (strain ATCC 17616 / 249)
Q2L2C0 5.52e-102 299 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella avium (strain 197N)
Q7VTC7 7.25e-102 299 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2F0 7.25e-102 299 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRB9 7.25e-102 299 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2UEL3 8.44e-102 298 65 0 209 3 rpsC Small ribosomal subunit protein uS3 Ralstonia pickettii (strain 12J)
Q8XV18 8.45e-102 298 65 0 209 3 rpsC Small ribosomal subunit protein uS3 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1B033 1.05e-101 297 67 0 208 3 rpsC Small ribosomal subunit protein uS3 Paracoccus denitrificans (strain Pd 1222)
Q1QN24 1.07e-101 297 64 1 226 3 rpsC Small ribosomal subunit protein uS3 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SLP3 1.32e-101 297 60 2 233 3 rpsC Small ribosomal subunit protein uS3 Thiobacillus denitrificans (strain ATCC 25259)
Q1GK28 1.35e-101 297 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Ruegeria sp. (strain TM1040)
A1AVK6 1.52e-101 297 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Ruthia magnifica subsp. Calyptogena magnifica
Q1LI43 1.53e-101 298 65 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A9IW20 1.97e-101 296 62 0 208 3 rpsC Small ribosomal subunit protein uS3 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q46WF0 3.28e-101 297 65 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B2IK68 4.12e-101 296 63 1 226 3 rpsC Small ribosomal subunit protein uS3 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B8ELF7 7.33e-101 295 63 1 226 3 rpsC Small ribosomal subunit protein uS3 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B9KL97 2.75e-100 294 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5R6 2.75e-100 294 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGL7 2.75e-100 294 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q5LW56 4.58e-100 293 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B3R7R7 6.86e-100 294 64 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K625 6.86e-100 294 64 0 209 3 rpsC Small ribosomal subunit protein uS3 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B1Y8I1 7.34e-100 295 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q6G2X1 7.76e-100 293 62 0 208 3 rpsC Small ribosomal subunit protein uS3 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q16AE5 9.33e-100 292 60 1 228 3 rpsC Small ribosomal subunit protein uS3 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1KRH9 9.38e-100 292 59 3 234 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66551 9.38e-100 292 59 3 234 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66550 9.38e-100 292 59 3 234 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3W0 9.38e-100 292 59 3 234 3 rpsC Small ribosomal subunit protein uS3 Neisseria meningitidis serogroup C (strain 053442)
A2SLF1 1.23e-99 294 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A5CXL0 1.79e-99 291 66 0 208 3 rpsC Small ribosomal subunit protein uS3 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A7HWR7 1.8e-99 291 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A4WVK2 2.04e-99 291 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B4RQY4 2.3e-99 291 58 3 234 3 rpsC Small ribosomal subunit protein uS3 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5T3 2.3e-99 291 58 3 234 3 rpsC Small ribosomal subunit protein uS3 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4R8M3 2.49e-99 292 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Phenylobacterium zucineum (strain HLK1)
Q6FZC8 5.44e-99 290 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Bartonella quintana (strain Toulouse)
B6JET9 7.69e-99 290 61 1 231 3 rpsC Small ribosomal subunit protein uS3 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A8LM60 8.1e-99 290 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q0BUP4 1.05e-98 289 62 2 226 3 rpsC Small ribosomal subunit protein uS3 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q9PE70 1.21e-98 290 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain 9a5c)
A6T3J8 1.21e-98 291 63 0 208 3 rpsC Small ribosomal subunit protein uS3 Janthinobacterium sp. (strain Marseille)
Q87E76 1.61e-98 289 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8H5 1.61e-98 289 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain M23)
Q1GPA5 2.54e-98 289 63 0 209 3 rpsC Small ribosomal subunit protein uS3 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B0T2C8 3.21e-98 289 65 0 208 3 rpsC Small ribosomal subunit protein uS3 Caulobacter sp. (strain K31)
A4G9T2 5.49e-98 290 62 0 208 3 rpsC Small ribosomal subunit protein uS3 Herminiimonas arsenicoxydans
B0U5K5 8.97e-98 287 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Xylella fastidiosa (strain M12)
A0L5X9 1.3e-97 286 64 1 208 3 rpsC Small ribosomal subunit protein uS3 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q0ANQ6 1.94e-97 286 60 1 231 3 rpsC Small ribosomal subunit protein uS3 Maricaulis maris (strain MCS10)
B8H4E0 2.65e-97 286 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8U7 2.65e-97 286 64 0 208 3 rpsC Small ribosomal subunit protein uS3 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q28UV4 4.82e-97 286 57 2 240 3 rpsC Small ribosomal subunit protein uS3 Jannaschia sp. (strain CCS1)
Q2G8X4 1.67e-96 284 62 0 209 3 rpsC Small ribosomal subunit protein uS3 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A5FZV9 4.48e-96 283 61 2 226 3 rpsC Small ribosomal subunit protein uS3 Acidiphilium cryptum (strain JF-5)
A9H3P5 1.32e-95 281 61 2 226 3 rpsC Small ribosomal subunit protein uS3 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q5FTY9 1.9e-95 281 61 2 226 3 rpsC Small ribosomal subunit protein uS3 Gluconobacter oxydans (strain 621H)
A5V5Z6 1.53e-94 279 59 0 209 3 rpsC Small ribosomal subunit protein uS3 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q5WZK6 4.75e-94 277 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila (strain Lens)
A8ESU9 9.71e-94 277 58 0 232 3 rpsC Small ribosomal subunit protein uS3 Aliarcobacter butzleri (strain RM4018)
Q5NQ59 9.9e-94 277 57 1 225 3 rpsC Small ribosomal subunit protein uS3 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5ZYN7 1.05e-93 276 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHQ8 1.05e-93 276 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila (strain Corby)
Q5X853 1.05e-93 276 69 1 208 3 rpsC Small ribosomal subunit protein uS3 Legionella pneumophila (strain Paris)
Q0BYC0 1.23e-93 277 57 1 232 3 rpsC Small ribosomal subunit protein uS3 Hyphomonas neptunium (strain ATCC 15444)
Q30TV8 2.56e-93 276 62 2 230 3 rpsC Small ribosomal subunit protein uS3 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A4J117 7.49e-93 274 58 1 222 3 rpsC Small ribosomal subunit protein uS3 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B3E7U1 1.07e-92 273 60 1 210 3 rpsC Small ribosomal subunit protein uS3 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A4IJJ5 1.44e-92 273 63 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacillus thermodenitrificans (strain NG80-2)
C5D3S3 1.85e-92 273 62 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacillus sp. (strain WCH70)
Q5L417 2.36e-92 273 62 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacillus kaustophilus (strain HTA426)
B1I1J4 6.44e-92 272 60 0 215 3 rpsC Small ribosomal subunit protein uS3 Desulforudis audaxviator (strain MP104C)
Q2N9B7 1.16e-91 271 60 0 209 3 rpsC Small ribosomal subunit protein uS3 Erythrobacter litoralis (strain HTCC2594)
B7GJ73 1.28e-91 271 62 1 208 3 rpsC Small ribosomal subunit protein uS3 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B9M6H2 6.02e-91 269 60 1 210 3 rpsC Small ribosomal subunit protein uS3 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A1ALU7 7.09e-91 269 59 1 210 3 rpsC Small ribosomal subunit protein uS3 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q7M8E0 7.09e-91 270 59 1 222 3 rpsC Small ribosomal subunit protein uS3 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A5GAX1 1.41e-90 268 60 1 210 3 rpsC Small ribosomal subunit protein uS3 Geotalea uraniireducens (strain Rf4)
A6QCQ4 2.16e-90 268 56 0 231 3 rpsC Small ribosomal subunit protein uS3 Sulfurovum sp. (strain NBC37-1)
P59182 2.53e-90 268 61 1 208 3 rpsC Small ribosomal subunit protein uS3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5HS96 5.46e-90 268 56 1 231 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni (strain RM1221)
A1W1V4 5.46e-90 268 56 1 231 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PLX7 5.46e-90 268 56 1 231 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FP15 5.46e-90 268 56 1 231 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q3A9S2 6.74e-90 267 58 0 208 3 rpsC Small ribosomal subunit protein uS3 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9ZJR9 8.37e-90 267 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain J99 / ATCC 700824)
Q250M6 9.86e-90 266 60 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulfitobacterium hafniense (strain Y51)
A7ZG06 1.4e-89 266 55 0 232 3 rpsC Small ribosomal subunit protein uS3 Campylobacter concisus (strain 13826)
A5D5G1 1.76e-89 266 57 0 208 3 rpsC Small ribosomal subunit protein uS3 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B5EFQ6 2.35e-89 265 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B9KEE6 2.5e-89 266 56 1 231 3 rpsC Small ribosomal subunit protein uS3 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
P21465 2.61e-89 265 59 1 208 1 rpsC Small ribosomal subunit protein uS3 Bacillus subtilis (strain 168)
C6E4Q1 3.09e-89 265 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Geobacter sp. (strain M21)
B2UV76 4.08e-89 265 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain Shi470)
Q1CRU7 4.08e-89 265 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain HPAG1)
B5Z8W1 4.08e-89 265 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain G27)
Q17ZD2 4.41e-89 265 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter acinonychis (strain Sheeba)
B5YG41 5.53e-89 264 62 1 210 3 rpsC Small ribosomal subunit protein uS3 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A4XLS4 6.14e-89 265 60 1 209 3 rpsC Small ribosomal subunit protein uS3 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A7H650 6.18e-89 265 56 1 233 3 rpsC Small ribosomal subunit protein uS3 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B6JNF1 6.32e-89 265 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain P12)
Q1WS96 6.75e-89 264 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Ligilactobacillus salivarius (strain UCC118)
Q748Z4 6.86e-89 264 58 1 210 3 rpsC Small ribosomal subunit protein uS3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q5WLQ6 8.51e-89 264 58 0 208 3 rpsC Small ribosomal subunit protein uS3 Shouchella clausii (strain KSM-K16)
B8G1X2 8.98e-89 264 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A7H106 1.19e-88 264 55 0 232 3 rpsC Small ribosomal subunit protein uS3 Campylobacter curvus (strain 525.92)
A6Q1I4 1.4e-88 264 60 0 208 3 rpsC Small ribosomal subunit protein uS3 Nitratiruptor sp. (strain SB155-2)
A7Z0P4 1.83e-88 263 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q3A6P1 1.89e-88 263 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A7GK26 1.95e-88 263 61 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
P23309 2.25e-88 263 61 1 208 1 rpsC Small ribosomal subunit protein uS3 Geobacillus stearothermophilus
C0Q9W7 2.42e-88 263 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q39Y00 2.52e-88 263 59 1 210 3 rpsC Small ribosomal subunit protein uS3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P56010 2.59e-88 263 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Helicobacter pylori (strain ATCC 700392 / 26695)
A3DJH8 3.78e-88 263 57 0 208 3 rpsC Small ribosomal subunit protein uS3 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B8D0D0 3.91e-88 262 57 0 208 3 rpsC Small ribosomal subunit protein uS3 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A8F991 4.47e-88 262 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus pumilus (strain SAFR-032)
Q65PA1 4.52e-88 262 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2LQ95 8.61e-88 261 59 1 216 3 rpsC Small ribosomal subunit protein uS3 Syntrophus aciditrophicus (strain SB)
B9MKH5 9.03e-88 261 58 1 217 3 rpsC Small ribosomal subunit protein uS3 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q1D769 9.22e-88 261 57 2 221 3 rpsC Small ribosomal subunit protein uS3 Myxococcus xanthus (strain DK1622)
Q2RFQ3 1.17e-87 261 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9Z9K8 1.76e-87 261 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8ZV63 3.03e-87 260 60 2 210 3 rpsC Small ribosomal subunit protein uS3 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A5VLJ9 6.25e-87 259 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Limosilactobacillus reuteri (strain DSM 20016)
Q6AP65 1.56e-86 258 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
C0ZII6 1.78e-86 258 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q4FLM4 1.93e-86 258 55 0 208 3 rpsC Small ribosomal subunit protein uS3 Pelagibacter ubique (strain HTCC1062)
A8YXL1 2.13e-86 258 56 2 226 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus helveticus (strain DPC 4571)
C1A6R1 3.28e-86 257 60 1 208 3 rpsC Small ribosomal subunit protein uS3 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A0ALW2 1.01e-85 256 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66548 1.01e-85 256 58 1 208 1 rpsC Small ribosomal subunit protein uS3 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WF2 1.01e-85 256 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Listeria monocytogenes serotype 4b (strain F2365)
P66549 1.01e-85 256 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7VGD8 1.19e-85 256 54 0 233 3 rpsC Small ribosomal subunit protein uS3 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q5FM84 2.25e-85 255 55 2 226 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B2TII1 2.28e-85 255 56 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Eklund 17B / Type B)
A0RM17 2.42e-85 256 54 0 232 3 rpsC Small ribosomal subunit protein uS3 Campylobacter fetus subsp. fetus (strain 82-40)
B1YGV6 2.74e-85 255 58 2 209 3 rpsC Small ribosomal subunit protein uS3 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B4UBA5 2.9e-85 255 55 1 213 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter sp. (strain K)
B8J866 2.9e-85 255 55 1 213 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A0LIJ6 3.46e-85 254 60 1 208 3 rpsC Small ribosomal subunit protein uS3 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B2UYB6 3.6e-85 255 56 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Alaska E43 / Type E3)
C4KZP0 3.8e-85 254 57 2 209 3 rpsC Small ribosomal subunit protein uS3 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B1HMX4 3.96e-85 254 58 1 215 3 rpsC Small ribosomal subunit protein uS3 Lysinibacillus sphaericus (strain C3-41)
Q2IJ82 4.54e-85 254 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q034Y9 6.21e-85 254 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q839F8 9.61e-85 254 58 1 208 1 rpsC Small ribosomal subunit protein uS3 Enterococcus faecalis (strain ATCC 700802 / V583)
B8FES9 1.44e-84 253 61 0 208 3 rpsC Small ribosomal subunit protein uS3 Desulfatibacillum aliphaticivorans
Q74L83 1.86e-84 253 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8MLE6 2.62e-84 253 57 1 209 3 rpsC Small ribosomal subunit protein uS3 Alkaliphilus oremlandii (strain OhILAs)
Q03EC2 2.66e-84 253 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B9L6M7 2.74e-84 253 54 2 234 3 rpsC Small ribosomal subunit protein uS3 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A7HBM4 2.78e-84 253 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Anaeromyxobacter sp. (strain Fw109-5)
Q046B9 3.17e-84 253 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5Z1V7 3.67e-84 254 54 2 222 3 rpsC Small ribosomal subunit protein uS3 Nocardia farcinica (strain IFM 10152)
B1IGE8 4.55e-84 252 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Okra / Type B1)
B2A4E5 7.62e-84 252 59 1 208 3 rpsC Small ribosomal subunit protein uS3 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A5I7K0 8.95e-84 251 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ63 8.95e-84 251 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain ATCC 19397 / Type A)
A7GJ68 1.02e-83 251 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q88XY0 1.38e-83 251 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q03IF7 1.41e-83 251 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A7HZL2 1.5e-83 251 56 1 221 3 rpsC Small ribosomal subunit protein uS3 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q11QB8 1.64e-83 252 57 1 209 3 rpsC Small ribosomal subunit protein uS3 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
C0MCB6 2.55e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U506 2.55e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8D5 2.55e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus equi subsp. equi (strain 4047)
C3KVP5 2.55e-83 250 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain 657 / Type Ba4)
B1KSL9 2.61e-83 250 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Loch Maree / Type A3)
C1FMU5 2.61e-83 250 53 1 223 3 rpsC Small ribosomal subunit protein uS3 Clostridium botulinum (strain Kyoto / Type A2)
Q1MPQ7 2.63e-83 250 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Lawsonia intracellularis (strain PHE/MN1-00)
A6LPR7 2.67e-83 250 55 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q5M2B9 2.72e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXR7 2.72e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus thermophilus (strain CNRZ 1066)
P59186 3.07e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6HPQ2 3.21e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H84 3.21e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cereus (strain ZK / E33L)
Q81J36 3.21e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q73F90 3.21e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81VS4 3.21e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus anthracis
A0R8I6 3.21e-83 250 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Bacillus thuringiensis (strain Al Hakam)
B2UMT3 3.44e-83 250 56 1 206 3 rpsC Small ribosomal subunit protein uS3 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q97EI4 4.97e-83 249 56 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A4VSG0 5.3e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus suis (strain 05ZYH33)
A4VYP9 5.3e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus suis (strain 98HAH33)
C1CP94 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA3 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain P1031)
C1CC12 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain JJA)
P0A4C4 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS46 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain CGSP14)
P0A4C3 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG3 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8K4 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAL8 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae (strain 70585)
B5E6G1 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MN0 5.41e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5PA64 5.58e-83 249 52 1 206 3 rpsC Small ribosomal subunit protein uS3 Anaplasma marginale (strain St. Maries)
B9KJ64 5.58e-83 249 52 1 206 3 rpsC Small ribosomal subunit protein uS3 Anaplasma marginale (strain Florida)
B8G6R9 6.78e-83 250 51 0 230 3 rpsC Small ribosomal subunit protein uS3 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q03PW3 6.89e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A6TWH6 7.89e-83 249 51 1 231 3 rpsC Small ribosomal subunit protein uS3 Alkaliphilus metalliredigens (strain QYMF)
P0DE91 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VU3 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC20 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J908 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ56 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP11 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE52 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66557 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEC9 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE90 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66555 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus pyogenes serotype M1
P66559 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66558 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3W3 9.15e-83 249 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P66554 9.45e-83 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain MW2)
Q6G777 9.45e-83 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain MSSA476)
Q6GEI9 9.45e-83 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain MRSA252)
P66553 9.45e-83 248 56 1 208 1 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain N315)
P66552 9.45e-83 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ86 9.45e-83 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain Newman)
Q2YYQ2 9.45e-83 248 56 1 208 1 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FW12 9.45e-83 248 56 1 208 1 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEP5 9.45e-83 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain USA300)
A7X5F5 9.45e-83 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8AZL9 1.05e-82 248 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q5HDW4 1.43e-82 248 55 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus aureus (strain COL)
B9DSV6 1.51e-82 248 57 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A3CK69 1.74e-82 248 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Streptococcus sanguinis (strain SK36)
Q4L8A8 2.05e-82 248 55 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus haemolyticus (strain JCSC1435)
B1MGE4 2.57e-82 249 51 3 237 3 rpsC Small ribosomal subunit protein uS3 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A8LC50 2.73e-82 251 54 1 218 3 rpsC Small ribosomal subunit protein uS3 Parafrankia sp. (strain EAN1pec)
Q38UR8 3.67e-82 247 55 1 208 3 rpsC Small ribosomal subunit protein uS3 Latilactobacillus sakei subsp. sakei (strain 23K)
Q2GL53 4.3e-82 247 51 1 206 3 rpsC Small ribosomal subunit protein uS3 Anaplasma phagocytophilum (strain HZ)
A0QSD7 5.7e-82 249 51 2 232 1 rpsC Small ribosomal subunit protein uS3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0SQF0 6.27e-82 247 54 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium perfringens (strain SM101 / Type A)
Q8XHS9 6.27e-82 247 54 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium perfringens (strain 13 / Type A)
Q0TMQ2 6.27e-82 247 54 1 209 3 rpsC Small ribosomal subunit protein uS3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B1GZ89 6.56e-82 247 56 1 208 3 rpsC Small ribosomal subunit protein uS3 Endomicrobium trichonymphae
Q2S3Q8 6.64e-82 247 51 2 235 3 rpsC Small ribosomal subunit protein uS3 Salinibacter ruber (strain DSM 13855 / M31)
Q49ZG2 7.87e-82 246 55 1 208 3 rpsC Small ribosomal subunit protein uS3 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q30Z48 8.03e-82 246 58 1 208 3 rpsC Small ribosomal subunit protein uS3 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A4FPL9 8.08e-82 249 53 2 217 3 rpsC Small ribosomal subunit protein uS3 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A0LRM6 9.23e-82 250 50 2 232 3 rpsC Small ribosomal subunit protein uS3 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q6MJ20 1.08e-81 246 53 0 208 3 rpsC Small ribosomal subunit protein uS3 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q47LJ9 1.12e-81 248 55 1 206 3 rpsC Small ribosomal subunit protein uS3 Thermobifida fusca (strain YX)
Q6NJC9 1.15e-81 247 56 2 211 3 rpsC Small ribosomal subunit protein uS3 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C5CC56 1.21e-81 248 54 1 211 3 rpsC Small ribosomal subunit protein uS3 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q0RRR5 1.28e-81 250 54 1 218 3 rpsC Small ribosomal subunit protein uS3 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A5USI3 1.3e-81 247 54 1 221 3 rpsC Small ribosomal subunit protein uS3 Roseiflexus sp. (strain RS-1)
Q2JFH0 1.37e-81 249 54 1 218 3 rpsC Small ribosomal subunit protein uS3 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18830
Feature type CDS
Gene rpsC
Product 30S ribosomal protein S3
Location 19337 - 20038 (strand: -1)
Length 702 (nucleotides) / 233 (amino acids)
In genomic island -

Contig

Accession ZDB_385
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2426
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00189 Ribosomal protein S3, C-terminal domain
PF07650 KH domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0092 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S3

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02982 small subunit ribosomal protein S3 Ribosome -

Protein Sequence

MGQKVNPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRKYLTKELEKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKSVSDIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAQTTYGVIGVKVWIFKGEILGGMAAVEQAEKPAAQPKKQQRKGRK

Flanking regions ( +/- flanking 50bp)

CAGCCACATCACTGTGGTTGTGTCCGATCGCTGATACCTGGAGACTAGCAATGGGTCAGAAAGTAAATCCAAATGGTATTCGCCTGGGTATTGTTAAACCTTGGAACTCTACCTGGTTTGCGAACACCAAAGAATTCGCTGACAACCTGGACAGCGACTTTAAAGTACGTAAGTACTTAACTAAAGAACTGGAAAAAGCGTCAGTATCCCGCATCGTTATCGAGCGCCCTGCTAAGAGCATCCGTGTGACTATTCACACTGCACGCCCTGGCATCGTGATCGGTAAGAAAGGTGAAGACGTTGAAAAACTGCGCAAAAGCGTTTCAGATATCGCTGGCGTTCCTGCGCAGATCAATATTGCCGAAGTACGTAAACCTGAACTGGACGCAAAATTAGTTGCTGACAGCATCACTTCACAGCTGGAACGTCGCGTTATGTTCCGTCGTGCTATGAAGCGTGCGGTACAGAATGCTATGCGTTTAGGCGCTAAAGGTATCAAAGTCGAAGTCAGCGGCCGTTTAGGCGGTGCTGAAATCGCACGTACTGAGTGGTATCGTGAAGGCCGTGTGCCTCTGCATACCCTGCGTGCAGACATCGATTATAACACCTCTGAAGCTCAGACTACTTATGGTGTTATCGGTGTTAAAGTGTGGATCTTCAAAGGTGAGATTCTGGGTGGCATGGCTGCAGTTGAACAGGCGGAAAAACCGGCTGCTCAACCTAAAAAACAGCAGCGTAAAGGCCGTAAGTAAAGGAGAGTCGCTGAATGTTACAACCAAAGCGTACAAAATTCCGTAAAGTG