Homologs in group_1335

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08255 FBDBKF_08255 92.8 Morganella morganii S1 rffA dTDP-4-amino-4,6-dideoxygalactose transaminase
EHELCC_13270 EHELCC_13270 92.8 Morganella morganii S2 rffA dTDP-4-amino-4,6-dideoxygalactose transaminase
NLDBIP_13610 NLDBIP_13610 92.8 Morganella morganii S4 rffA dTDP-4-amino-4,6-dideoxygalactose transaminase
LHKJJB_12945 LHKJJB_12945 92.8 Morganella morganii S3 rffA dTDP-4-amino-4,6-dideoxygalactose transaminase
HKOGLL_12085 HKOGLL_12085 92.8 Morganella morganii S5 rffA dTDP-4-amino-4,6-dideoxygalactose transaminase
PMI_RS16515 PMI_RS16515 84.3 Proteus mirabilis HI4320 rffA dTDP-4-amino-4,6-dideoxygalactose transaminase

Distribution of the homologs in the orthogroup group_1335

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1335

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P27833 0.0 632 76 0 376 1 wecE dTDP-4-amino-4,6-dideoxygalactose transaminase Escherichia coli (strain K12)
Q58466 4.31e-61 204 35 9 359 3 MJ1066 Uncharacterized protein MJ1066 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q4KC84 5.2e-55 188 32 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3KCC3 1e-51 179 32 11 386 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pseudomonas fluorescens (strain Pf0-1)
P39623 4.02e-50 176 30 7 380 3 spsC Spore coat polysaccharide biosynthesis protein SpsC Bacillus subtilis (strain 168)
P15263 1.74e-49 173 33 4 319 3 degT Pleiotropic regulatory protein Geobacillus stearothermophilus
A4WAM5 5.48e-49 172 31 8 379 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Enterobacter sp. (strain 638)
Q2NRV5 2.86e-48 170 30 10 384 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Sodalis glossinidius (strain morsitans)
C0Q071 6.86e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella paratyphi C (strain RKS4594)
B4SYW9 6.86e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella newport (strain SL254)
B4TBG4 6.86e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella heidelberg (strain SL476)
B5BCP8 7.54e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella paratyphi A (strain AKU_12601)
Q5PNA4 7.54e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9N5B4 8.65e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RCC2 8.65e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R270 8.65e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5FNT7 8.65e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella dublin (strain CT_02021853)
B5EZH6 8.65e-48 169 32 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella agona (strain SL483)
Q8ZNF3 8.84e-48 169 32 9 375 1 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z542 9.21e-48 169 32 9 374 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella typhi
B4TPI0 1.12e-47 169 32 9 374 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella schwarzengrund (strain CVM19633)
A8GDR5 1.73e-47 168 31 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Serratia proteamaculans (strain 568)
Q4ZSZ4 6.62e-47 167 30 11 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pseudomonas syringae pv. syringae (strain B728a)
Q57M57 1.08e-46 166 31 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Salmonella choleraesuis (strain SC-B67)
Q02R23 1.17e-46 166 31 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1P2 1.38e-46 166 30 10 389 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pseudomonas aeruginosa (strain PA7)
B7VBN4 5.75e-46 164 31 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pseudomonas aeruginosa (strain LESB58)
Q9HY65 8.13e-46 164 31 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B1IXT4 2.88e-45 162 30 9 380 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7N5L8 4.47e-45 162 30 9 380 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B4ETL5 4.88e-45 162 29 9 383 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Proteus mirabilis (strain HI4320)
A1JPP9 8.33e-45 161 31 9 375 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6TFA0 9.31e-45 161 30 8 380 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2VBJ1 1.11e-44 161 30 10 379 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5XTK7 1.22e-44 161 30 10 381 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Klebsiella pneumoniae (strain 342)
Q6D2E9 1.5e-44 160 29 9 377 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JJ28 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q7BF87 1.99e-44 160 30 10 378 2 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIM2 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pestis (strain Pestoides F)
Q1CIH5 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R095 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pestis bv. Antiqua (strain Angola)
Q93PE0 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pestis
B2K5L5 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C740 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHH2 1.99e-44 160 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7LM78 7.72e-44 159 30 10 378 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R9G2 1.64e-43 158 30 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain UTI89 / UPEC)
Q8FFM3 1.64e-43 158 30 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFI9 1.64e-43 158 30 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ADA5 1.64e-43 158 30 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O1:K1 / APEC
B7MG20 1.64e-43 158 30 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7M5T5 3.9e-43 157 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O8 (strain IAI1)
A0KGY8 5.73e-43 156 29 10 383 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SQW7 5.86e-43 156 29 11 384 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Aeromonas salmonicida (strain A449)
B7MXT4 7.53e-43 156 30 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O81 (strain ED1a)
B7UFR5 7.61e-43 156 30 11 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q31YK4 9.38e-43 156 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Shigella boydii serotype 4 (strain Sb227)
B1LLK7 9.38e-43 156 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I7J6 9.38e-43 156 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain SE11)
B7LAR8 9.38e-43 156 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain 55989 / EAEC)
A7ZP71 9.38e-43 156 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NNT2 1.26e-42 155 29 11 388 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q9A9H3 1.37e-42 155 31 8 334 1 per GDP-perosamine synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q83QT9 2.16e-42 155 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Shigella flexneri
Q0T2N0 2.16e-42 155 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Shigella flexneri serotype 5b (strain 8401)
B5YX44 2.23e-42 155 29 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q7AC24 2.23e-42 155 29 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O157:H7
Q7N3Q5 3.88e-42 154 28 10 383 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P77690 4.01e-42 154 30 10 382 1 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain K12)
A8A2C0 4.17e-42 154 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli O9:H4 (strain HS)
B1X8W6 4.17e-42 154 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZU95 4.17e-42 154 30 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
Q3YZV3 5.7e-42 154 29 10 382 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Shigella sonnei (strain Ss046)
C5BDQ4 1.55e-41 152 29 11 385 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Edwardsiella ictaluri (strain 93-146)
B7JA35 2.36e-41 152 29 9 368 1 gnnB UDP-N-acetyl-3-dehydro-alpha-D-glucosamine 3-aminotranferase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
C6DAW7 6.25e-41 151 28 9 377 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6T1W6 7.26e-41 150 34 4 268 1 fdtB dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase Aneurinibacillus thermoaerophilus
A8FRR4 2e-39 147 27 7 387 3 arnB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase Shewanella sediminis (strain HAW-EB3)
Q795J3 3.92e-39 146 29 6 382 2 epsN Putative pyridoxal phosphate-dependent aminotransferase EpsN Bacillus subtilis (strain 168)
P14290 1.3e-38 144 28 6 345 3 eryC1 Erythromycin biosynthesis sensory transduction protein EryC1 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q7DBF3 2.1e-38 144 28 7 381 1 perA GDP-perosamine synthase Escherichia coli O157:H7
Q9ZGH4 4.05e-38 143 29 6 320 1 desV dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase Streptomyces venezuelae
Q06953 1.29e-36 139 25 7 381 1 rfbE GDP-perosamine synthase Vibrio cholerae
Q07608 1.91e-36 141 35 8 267 3 mosB Protein MosB Rhizobium meliloti
Q8G8Y2 2.21e-36 139 30 8 333 1 btrR L-glutamine:2-deoxy-scyllo-inosose aminotransferase Niallia circulans
Q8EEB1 8.44e-36 137 34 4 253 1 kdnA 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9HZ76 3.75e-35 135 32 7 305 1 wbpE UDP-2-acetamido-2-deoxy-3-oxo-D-glucuronate aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ALN9 6.01e-35 135 28 10 371 1 spnR dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase Saccharopolyspora spinosa
Q2MF12 5.84e-34 133 31 3 259 3 tobS2 Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / JCM 4838 / CBS 697.72 / NBRC 16177 / NCIMB 11028 / NRRL B-12390 / A12253. 1 / ISP 5477)
Q9F837 1.04e-33 131 27 5 361 1 megDII dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase Micromonospora megalomicea subsp. nigra
Q70KD4 1.58e-33 132 30 5 286 3 gtmD Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase Micromonospora echinospora
Q6U1I3 1.93e-31 125 27 10 374 1 vioA dTDP-4-amino-4,6-dideoxy-D-glucose transaminase Shigella dysenteriae
Q2MF17 2.1e-31 126 30 6 294 3 tbmB L-glutamine:2-deoxy-scyllo-inosose aminotransferase Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / JCM 4838 / CBS 697.72 / NBRC 16177 / NCIMB 11028 / NRRL B-12390 / A12253. 1 / ISP 5477)
O07566 3.47e-31 126 28 6 340 1 ntdA 3-oxo-glucose-6-phosphate:glutamate aminotransferase Bacillus subtilis (strain 168)
Q6L739 4.47e-31 125 31 6 268 1 kanB L-glutamine:2-deoxy-scyllo-inosose aminotransferase Streptomyces kanamyceticus
Q6L733 5.19e-31 125 33 2 217 3 kanD Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase Streptomyces kanamyceticus
P25048 7.4e-31 124 28 8 329 3 dnrJ Daunorubicin biosynthesis sensory transduction protein DnrJ Streptomyces peucetius
Q2MFP2 2.94e-30 123 33 6 266 3 parS L-glutamine:2-deoxy-scyllo-inosose aminotransferase Streptomyces paromomycinus
P77952 7.76e-30 122 29 5 292 1 stsC L-glutamine:scyllo-inosose aminotransferase Streptomyces griseus
Q2MF71 1.55e-29 121 32 5 248 3 livS L-glutamine:2-deoxy-scyllo-inosose aminotransferase Streptomyces lividus
P26398 3.1e-29 120 28 11 405 3 rfbH Lipopolysaccharide biosynthesis protein RfbH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6QVU4 1.5e-28 118 31 6 279 3 gntA L-glutamine:2-deoxy-scyllo-inosose aminotransferase Micromonospora echinospora
Q4R0W2 6.59e-28 116 33 6 250 1 rbmB L-glutamine:2-deoxy-scyllo-inosose aminotransferase Streptomyces ribosidificus
O25130 2.96e-27 114 32 5 212 1 pseC UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase Helicobacter pylori (strain ATCC 700392 / 26695)
Q5QKR7 7.89e-26 110 29 6 267 3 pseC UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9XCW4 2.17e-25 108 26 8 379 1 vioA dTDP-4-amino-4,6-dideoxy-D-glucose transaminase Escherichia coli
Q53U20 3e-25 109 33 3 209 1 neoB L-glutamine:2-deoxy-scyllo-inosose aminotransferase Streptomyces fradiae
Q0P9D3 7.14e-24 104 28 5 260 1 pglE UDP-N-acetylbacillosamine transaminase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
O52552 2.72e-23 103 30 8 260 1 rifK 3-amino-5-hydroxybenzoate synthase Amycolatopsis mediterranei (strain S699)
Q0P8W3 6.92e-23 102 28 6 267 1 pseC UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9ALN8 2.15e-21 98 33 4 223 1 spnQ dTDP-4-dehydro-2,6-dideoxy-D-glucose 3-dehydratase Saccharopolyspora spinosa
G4WJD4 5.49e-18 88 30 3 191 1 colD GDP-4-keto-6-deoxy-D-mannose 3-dehydratase Yersinia pseudotuberculosis
D3QY10 1.24e-17 87 28 3 202 1 colD GDP-4-keto-6-deoxy-D-mannose 3-dehydratase Escherichia coli O55:H7 (strain CB9615 / EPEC)
P9WGJ7 2.25e-09 62 31 5 151 2 Rv3402c Protein Rv3402c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGJ6 2.25e-09 62 31 5 151 3 MT3510 Protein MT3510 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TWJ6 6.6e-09 60 31 5 151 3 BQ2027_MB3436C Protein Mb3436c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5UPL1 6.17e-06 51 24 10 245 1 MIMI_L136 Uncharacterized protein L136 Acanthamoeba polyphaga mimivirus
Q60317 4.99e-05 48 31 4 110 3 MJ0001 Probable aspartate aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P14909 0.000529 45 26 3 104 1 aspC Aspartate aminotransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q819L4 0.000557 45 24 3 133 3 speA Arginine decarboxylase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P16524 0.00056 45 30 3 112 1 dapX Probable N-acetyl-LL-diaminopimelate aminotransferase Bacillus subtilis (strain 168)
Q81MS2 0.000756 45 24 3 133 3 speA Arginine decarboxylase Bacillus anthracis
P21885 0.000767 45 25 2 133 1 speA Arginine decarboxylase Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18805
Feature type CDS
Gene rffA
Product dTDP-4-amino-4,6-dideoxygalactose transaminase
Location 30209 - 31339 (strand: 1)
Length 1131 (nucleotides) / 376 (amino acids)

Contig

Accession term accessions NZ_VXKB01000010 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 36620 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1335
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01041 DegT/DnrJ/EryC1/StrS aminotransferase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0399 Cell wall/membrane/envelope biogenesis (M) M dTDP-4-amino-4,6-dideoxygalactose transaminase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02805 dTDP-4-amino-4,6-dideoxygalactose transaminase [EC:2.6.1.59] O-Antigen nucleotide sugar biosynthesis
Metabolic pathways
Biosynthesis of nucleotide sugars		 -

Protein Sequence

MIPFNKPPVVGTEVGYMQQAMTSGKLCGDGQFTKKCEEWMEKRFGSAKVLLTPSCTASLEMAAILLDIQAGDEIIMPSYTFVSTSNAFVLRGAKVVFVDIRPDTMNIDETKIEAAITEKTKAIVPVHYAGVACEMDTIMALAKKYNLYVVEDAAQGVMSTYKGRALGSIGHIGCYSFHETKNYSSGGEGGATLINDPAMIPRAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQAAYLWAQLEEAEKINERRLAFWQIYYDALTPLAEDGLLTLPVVPEGMEQNAHMFYIKLKDVEERTAFNEFMKSHDVLTVFHYVPLHSCPAGVEFGRFNGEDIFTSRESDRLVRLPMFYNMKEDEQQTVIRLIKDFFA

Flanking regions ( +/- flanking 50bp)

AAGTGGCGGTACGATTGACAGTACAGCCTATTGGTTATACCGAGGATGCAATGATTCCATTTAATAAACCACCTGTAGTCGGCACTGAAGTTGGGTATATGCAGCAGGCCATGACCAGCGGCAAGTTGTGTGGTGACGGACAGTTCACCAAAAAATGTGAAGAATGGATGGAAAAACGGTTTGGCAGCGCTAAAGTCCTGCTGACACCATCTTGTACTGCATCATTGGAAATGGCAGCAATTCTGCTGGATATTCAGGCGGGTGATGAAATCATCATGCCGAGCTACACCTTTGTTTCTACCTCGAACGCCTTTGTATTGCGCGGCGCGAAAGTAGTATTTGTGGATATCCGTCCGGATACCATGAATATTGATGAAACCAAAATCGAAGCGGCAATCACAGAGAAAACCAAAGCGATTGTACCGGTGCATTATGCGGGCGTGGCCTGTGAAATGGACACCATCATGGCACTGGCGAAGAAATATAACCTGTATGTGGTGGAAGATGCCGCACAGGGCGTGATGTCGACTTATAAAGGCCGCGCACTCGGGTCAATTGGTCATATCGGCTGTTACAGCTTCCATGAAACCAAAAACTACTCTTCCGGTGGCGAAGGCGGTGCAACGCTGATTAACGACCCCGCGATGATCCCGCGTGCAGAAATTATCCGCGAGAAAGGCACCAACCGCAGCCAGTTCTTCCGTGGTCAGGTGGATAAATATACCTGGCGTGATATCGGCTCCAGCTATCTGATGTCTGACTTACAGGCCGCTTATCTGTGGGCGCAACTGGAAGAAGCAGAAAAAATTAATGAGCGCCGTCTGGCATTCTGGCAGATTTACTACGATGCACTGACGCCGCTGGCGGAAGATGGTCTGCTGACGCTGCCGGTTGTACCGGAAGGCATGGAGCAGAATGCGCACATGTTCTACATCAAGCTGAAAGATGTGGAAGAGCGCACAGCATTCAATGAATTTATGAAATCACATGATGTATTGACGGTATTCCATTATGTGCCGCTGCACAGCTGTCCGGCAGGGGTGGAATTCGGACGTTTCAATGGTGAGGATATCTTTACCTCCCGTGAAAGTGATCGCCTGGTGCGCCTGCCGATGTTCTACAACATGAAAGAAGACGAGCAGCAAACTGTGATCCGTCTGATTAAGGATTTCTTCGCGTAATATGTCTTTAGCCAGAGCATCAATCTGGACGGCCGGCTCCACCCTGATCA