Homologs in group_1375

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08150 FBDBKF_08150 89.3 Morganella morganii S1 yifE UPF0438 protein YifE
EHELCC_13380 EHELCC_13380 89.3 Morganella morganii S2 yifE UPF0438 protein YifE
NLDBIP_13715 NLDBIP_13715 89.3 Morganella morganii S4 yifE UPF0438 protein YifE
LHKJJB_12840 LHKJJB_12840 89.3 Morganella morganii S3 yifE UPF0438 protein YifE
HKOGLL_12190 HKOGLL_12190 89.3 Morganella morganii S5 yifE UPF0438 protein YifE
PMI_RS16385 PMI_RS16385 75.9 Proteus mirabilis HI4320 - DUF413 domain-containing protein

Distribution of the homologs in the orthogroup group_1375

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1375

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADN5 5.91e-63 189 78 0 112 3 yifE UPF0438 protein YifE Shigella flexneri
P0ADN2 5.91e-63 189 78 0 112 1 yifE UPF0438 protein YifE Escherichia coli (strain K12)
P0ADN3 5.91e-63 189 78 0 112 3 yifE UPF0438 protein YifE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADN4 5.91e-63 189 78 0 112 3 yifE UPF0438 protein YifE Escherichia coli O157:H7
Q7CPD8 2.7e-60 183 75 0 112 3 yifE UPF0438 protein YifE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9L6T3 2.7e-60 183 75 0 112 3 yifE UPF0438 protein YifE Salmonella typhi
Q5PJY9 2.7e-60 183 75 0 112 3 yifE UPF0438 protein YifE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57HV1 2.7e-60 183 75 0 112 3 yifE UPF0438 protein YifE Salmonella choleraesuis (strain SC-B67)
P31811 1.23e-32 113 53 1 109 1 HI_0847 UPF0438 protein HI_0847 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18675
Feature type CDS
Gene -
Product DUF413 domain-containing protein
Location 1697 - 2035 (strand: 1)
Length 339 (nucleotides) / 112 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000010
Length 36620 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1375
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04219 Protein of unknown function, DUF

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3085 Function unknown (S) S Uncharacterized conserved protein YifE, UPF0438 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09897 uncharacterized protein - -

Protein Sequence

MEESFITTNRFFDNKHYPRGFSRHGHFTIKEAQLLEHHGFAFNELDMGKRTPRTDEEKLFVSVCRGERLPVTAAEKVWIKYLECTRKPKRFHTLSGGKPQVDPSEDYTDSDD

Flanking regions ( +/- flanking 50bp)

ATACTCCGCGCCATAAAGAGTAAGTTAGTAGAGAATTAGGAGTGTGTCAGATGGAAGAAAGCTTTATCACGACTAATCGTTTTTTTGATAATAAACATTATCCTCGTGGTTTTTCACGCCATGGTCATTTCACGATCAAAGAAGCTCAGTTACTTGAGCACCATGGTTTTGCTTTCAACGAACTGGACATGGGTAAACGTACTCCCCGGACGGATGAAGAAAAACTGTTTGTTTCCGTATGCCGTGGTGAACGACTGCCGGTGACAGCAGCAGAAAAAGTATGGATCAAGTATCTGGAATGCACCCGCAAACCAAAACGCTTCCATACTCTGTCCGGTGGTAAACCCCAGGTCGATCCGTCGGAAGACTATACCGACAGCGATGATTAATATCATCAGAAATAATAAGTTAAAAGGGGCATTCGTGCCCCTTTCATTTT