Homologs in group_1317

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08150 FBDBKF_08150 100.0 Morganella morganii S1 yifE UPF0438 protein YifE
NLDBIP_13715 NLDBIP_13715 100.0 Morganella morganii S4 yifE UPF0438 protein YifE
LHKJJB_12840 LHKJJB_12840 100.0 Morganella morganii S3 yifE UPF0438 protein YifE
HKOGLL_12190 HKOGLL_12190 100.0 Morganella morganii S5 yifE UPF0438 protein YifE
F4V73_RS18675 F4V73_RS18675 89.3 Morganella psychrotolerans - DUF413 domain-containing protein
PMI_RS16385 PMI_RS16385 78.6 Proteus mirabilis HI4320 - DUF413 domain-containing protein

Distribution of the homologs in the orthogroup group_1317

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1317

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADN5 1.89e-63 191 77 0 112 3 yifE UPF0438 protein YifE Shigella flexneri
P0ADN2 1.89e-63 191 77 0 112 1 yifE UPF0438 protein YifE Escherichia coli (strain K12)
P0ADN3 1.89e-63 191 77 0 112 3 yifE UPF0438 protein YifE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADN4 1.89e-63 191 77 0 112 3 yifE UPF0438 protein YifE Escherichia coli O157:H7
Q7CPD8 4.22e-61 185 75 0 112 3 yifE UPF0438 protein YifE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9L6T3 4.22e-61 185 75 0 112 3 yifE UPF0438 protein YifE Salmonella typhi
Q5PJY9 4.22e-61 185 75 0 112 3 yifE UPF0438 protein YifE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57HV1 4.22e-61 185 75 0 112 3 yifE UPF0438 protein YifE Salmonella choleraesuis (strain SC-B67)
P31811 6.45e-37 124 56 1 109 1 HI_0847 UPF0438 protein HI_0847 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13380
Feature type CDS
Gene yifE
Product UPF0438 protein YifE
Location 160657 - 160995 (strand: -1)
Length 339 (nucleotides) / 112 (amino acids)

Contig

Accession ZDB_222
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1317
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04219 Protein of unknown function, DUF

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3085 Function unknown (S) S Uncharacterized conserved protein YifE, UPF0438 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09897 uncharacterized protein - -

Protein Sequence

MAESFITTNRFFDNKHYPRGFSRHGHFTIKEAQLLERHGFAFNELDMGKRAPQTDEEKQFVSVCRGERMPETAEEKVWIKYLERIRKPKRFHTLSGGKPQIDPSEDYTDTDD

Flanking regions ( +/- flanking 50bp)

ATACTCCGCGCCATAAAGAGTATGTCAGTAGAGAATTAGGAGTGTGTCAGATGGCAGAAAGCTTTATCACGACTAATCGTTTTTTTGATAATAAACATTATCCTCGTGGTTTTTCACGCCATGGTCATTTCACCATAAAAGAAGCTCAGTTACTTGAGCGCCATGGTTTTGCTTTCAACGAACTGGATATGGGTAAACGCGCCCCCCAGACGGACGAAGAAAAACAGTTTGTTTCTGTATGCCGTGGTGAGCGTATGCCGGAAACAGCAGAAGAAAAAGTGTGGATTAAGTATCTGGAGCGTATTCGCAAACCAAAACGCTTCCACACGCTGTCCGGTGGTAAACCTCAGATCGATCCGTCGGAAGACTATACCGACACAGATGATTAATATCATCAGAAATAATAAGTTAAAAGGGGCATTCGTGCCCCTTTCTTTTT