Homologs in group_2419

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19530 FBDBKF_19530 81.3 Morganella morganii S1 ubiC chorismate lyase
EHELCC_16475 EHELCC_16475 81.3 Morganella morganii S2 ubiC chorismate lyase
NLDBIP_16685 NLDBIP_16685 81.3 Morganella morganii S4 ubiC chorismate lyase
LHKJJB_16785 LHKJJB_16785 81.3 Morganella morganii S3 ubiC chorismate lyase
HKOGLL_18830 HKOGLL_18830 81.3 Morganella morganii S5 ubiC chorismate lyase
PMI_RS13570 PMI_RS13570 56.0 Proteus mirabilis HI4320 ubiC chorismate lyase

Distribution of the homologs in the orthogroup group_2419

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2419

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JNE7 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FH1 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRU9 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pestis (strain Pestoides F)
Q1CE94 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYL0 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ20 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pestis
B2K1U3 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0T7 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNA0 2.11e-59 185 59 2 157 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GKB8 7.83e-59 184 60 2 161 3 ubiC Chorismate pyruvate-lyase Serratia proteamaculans (strain 568)
Q6FZ67 1.9e-58 183 58 2 162 3 ubiC Probable chorismate pyruvate-lyase Bartonella quintana (strain Toulouse)
A1UTE7 2.42e-58 182 56 2 159 3 ubiC Probable chorismate pyruvate-lyase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6G5M1 6.4e-58 181 56 2 161 3 ubiC Probable chorismate pyruvate-lyase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7MZB5 2.87e-57 180 55 2 164 3 ubiC Chorismate pyruvate-lyase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JRU5 5.52e-57 179 57 2 159 3 ubiC Chorismate pyruvate-lyase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4EYR7 1.4e-55 176 54 2 168 3 ubiC Chorismate pyruvate-lyase Proteus mirabilis (strain HI4320)
A7MPN9 6e-52 166 56 1 154 3 ubiC Chorismate pyruvate-lyase Cronobacter sakazakii (strain ATCC BAA-894)
A6TGU8 8.74e-52 166 58 1 147 3 ubiC Chorismate pyruvate-lyase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2VKA5 1.05e-51 166 56 2 156 3 ubiC Chorismate pyruvate-lyase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5XXZ3 2.52e-51 164 60 1 140 3 ubiC Chorismate pyruvate-lyase Klebsiella pneumoniae (strain 342)
A9IWF5 3.86e-48 157 52 4 164 3 ubiC Probable chorismate pyruvate-lyase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A4W5F2 2.11e-47 154 54 2 151 3 ubiC Chorismate pyruvate-lyase Enterobacter sp. (strain 638)
C4K6Q1 3.12e-47 154 51 1 151 3 ubiC Chorismate pyruvate-lyase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C0Q4D8 1.39e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi C (strain RKS4594)
A9N1L2 1.39e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T1S8 1.39e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella newport (strain SL254)
B4TDL6 1.39e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella heidelberg (strain SL476)
B5FQQ7 1.39e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella dublin (strain CT_02021853)
Q57GZ4 1.39e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella choleraesuis (strain SC-B67)
B5F1Q2 1.39e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella agona (strain SL483)
B5R7T2 1.41e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8ZKI0 1.42e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BJV6 1.42e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi A (strain AKU_12601)
Q5PL18 1.42e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5QZ58 1.42e-46 152 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella enteritidis PT4 (strain P125109)
C6DKC8 1.54e-46 153 52 1 153 3 ubiC Chorismate pyruvate-lyase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4TQQ1 3.83e-46 151 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella schwarzengrund (strain CVM19633)
Q3YUU5 7.45e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Shigella sonnei (strain Ss046)
Q8Z1T7 7.45e-46 150 53 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella typhi
Q83IP6 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Shigella flexneri
Q0SXQ6 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Shigella flexneri serotype 5b (strain 8401)
Q31TU7 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Shigella boydii serotype 4 (strain Sb227)
B2TX77 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LPK4 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain SMS-3-5 / SECEC)
B6I5Q4 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain SE11)
B1IUL3 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A7D9 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O9:H4 (strain HS)
A7ZUR1 7.95e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MH91 8.31e-46 150 54 2 151 3 ubiC Chorismate pyruvate-lyase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q327U6 8.4e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Shigella dysenteriae serotype 1 (strain Sd197)
B7NFY3 8.4e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7M7V2 8.4e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O8 (strain IAI1)
B7LAY7 8.4e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain 55989 / EAEC)
Q1R3P7 9.16e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain UTI89 / UPEC)
Q8FB35 9.16e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA23 9.16e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIL6 9.16e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O1:K1 / APEC
B7N2P6 9.16e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O81 (strain ED1a)
B7MJ29 9.16e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPK0 9.16e-46 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P26602 1.39e-45 150 53 2 149 1 ubiC Chorismate pyruvate-lyase Escherichia coli (strain K12)
B1XC38 1.39e-45 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain K12 / DH10B)
C5A132 1.39e-45 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z180 1.46e-45 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XEC3 1.46e-45 150 53 2 149 3 ubiC Chorismate pyruvate-lyase Escherichia coli O157:H7
B7NS03 3.1e-45 149 54 1 142 3 ubiC Chorismate pyruvate-lyase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A8AN89 1.31e-44 147 53 2 149 3 ubiC Chorismate pyruvate-lyase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6D9I9 2.23e-44 147 51 1 153 3 ubiC Chorismate pyruvate-lyase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NR06 1.78e-37 130 46 3 157 3 ubiC Chorismate pyruvate-lyase Sodalis glossinidius (strain morsitans)
Q6LVS4 1.34e-26 102 37 2 148 3 ubiC Probable chorismate pyruvate-lyase Photobacterium profundum (strain SS9)
Q87KM8 8.69e-25 97 38 2 144 3 ubiC Probable chorismate pyruvate-lyase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5E206 4.75e-23 93 37 4 146 3 ubiC Probable chorismate pyruvate-lyase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9KVP6 6.33e-23 92 34 2 144 3 ubiC Probable chorismate pyruvate-lyase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DD50 1.2e-21 89 36 2 144 3 ubiC Probable chorismate pyruvate-lyase Vibrio vulnificus (strain CMCP6)
Q7MQ88 2.64e-21 88 36 2 144 3 ubiC Probable chorismate pyruvate-lyase Vibrio vulnificus (strain YJ016)
A3QJG1 1.64e-16 76 30 3 160 3 ubiC Probable chorismate pyruvate-lyase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1U6P4 2.35e-15 73 40 0 96 3 ubiC Probable chorismate pyruvate-lyase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1SBR9 1.31e-14 71 32 6 173 3 ubiC Probable chorismate pyruvate-lyase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KEP8 2.33e-14 70 33 3 150 3 ubiC Probable chorismate pyruvate-lyase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q48AM0 3.2e-14 70 27 4 172 3 ubiC Probable chorismate pyruvate-lyase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0A5V8 6.32e-14 69 32 4 158 3 ubiC Probable chorismate pyruvate-lyase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q12T34 2.26e-13 68 28 4 173 3 ubiC Probable chorismate pyruvate-lyase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q82TP3 3.19e-13 67 29 2 171 3 ubiC Probable chorismate pyruvate-lyase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A3M775 5.37e-13 66 26 4 162 3 ubiC Probable chorismate pyruvate-lyase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q0AGZ8 1.26e-12 65 28 2 171 3 ubiC Probable chorismate pyruvate-lyase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q02E05 2.27e-12 65 30 5 165 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q0VTA8 2.55e-12 65 30 4 148 3 ubiC Probable chorismate pyruvate-lyase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3SLJ3 4.88e-12 64 28 3 167 3 ubiC Probable chorismate pyruvate-lyase Thiobacillus denitrificans (strain ATCC 25259)
Q609A0 5.48e-12 63 31 3 151 3 ubiC Probable chorismate pyruvate-lyase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9HTK1 5.96e-12 63 29 5 164 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4K3M0 6.39e-12 63 28 5 178 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K4G4 9.33e-12 63 29 5 165 3 ubiC2 Probable chorismate pyruvate-lyase 2 Pseudomonas fluorescens (strain Pf0-1)
A4STB6 2.15e-11 62 32 4 159 3 ubiC Probable chorismate pyruvate-lyase Aeromonas salmonicida (strain A449)
A1T086 2.41e-11 62 26 7 191 3 ubiC Probable chorismate pyruvate-lyase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8EKG2 7.22e-11 61 25 3 167 3 ubiC Probable chorismate pyruvate-lyase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1WVN0 1.14e-10 60 33 4 153 3 ubiC Probable chorismate pyruvate-lyase Halorhodospira halophila (strain DSM 244 / SL1)
Q1GXB4 1.16e-10 60 27 4 155 3 ubiC Probable chorismate pyruvate-lyase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q08A04 1.67e-10 60 26 4 182 3 ubiC Probable chorismate pyruvate-lyase Shewanella frigidimarina (strain NCIMB 400)
Q31DN1 6.05e-10 58 28 3 157 3 ubiC Probable chorismate pyruvate-lyase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A0KRF0 8.74e-10 58 25 4 167 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain ANA-3)
Q9FD32 9.09e-10 58 29 1 146 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas putida
Q15ZU0 1.05e-09 58 24 5 169 3 ubiC Probable chorismate pyruvate-lyase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5P5L9 1.2e-09 57 28 3 154 3 ubiC Probable chorismate pyruvate-lyase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0HP10 1.23e-09 58 25 4 167 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain MR-4)
Q0I0H9 1.35e-09 57 25 4 167 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain MR-7)
Q4FUZ9 2.06e-09 57 29 2 109 3 ubiC Probable chorismate pyruvate-lyase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9CMB5 2.31e-09 57 27 4 143 3 ubiC Probable chorismate pyruvate-lyase Pasteurella multocida (strain Pm70)
Q2Y5S2 2.33e-09 57 28 5 170 3 ubiC Probable chorismate pyruvate-lyase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1RQ05 2.54e-09 57 25 5 175 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain W3-18-1)
Q6F9N7 4.34e-09 56 27 7 165 3 ubiC Probable chorismate pyruvate-lyase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4ZLB5 6.42e-09 55 27 5 165 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas syringae pv. syringae (strain B728a)
Q1QE02 1.4e-08 54 28 2 108 3 ubiC Probable chorismate pyruvate-lyase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q88C66 1.7e-08 54 29 5 157 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q87U40 2.91e-08 54 26 4 157 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48BQ6 4.11e-08 53 27 4 157 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5QUP2 9.24e-08 52 27 4 158 3 ubiC Probable chorismate pyruvate-lyase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1QSG3 9.92e-08 52 27 3 162 3 ubiC Probable chorismate pyruvate-lyase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1I2R4 1.6e-07 52 29 4 157 3 ubiC2 Probable chorismate pyruvate-lyase 2 Pseudomonas entomophila (strain L48)
Q47AZ9 1.15e-06 49 29 3 157 3 ubiC Probable chorismate pyruvate-lyase Dechloromonas aromatica (strain RCB)
Q83F94 1.83e-06 49 28 6 171 3 ubiC Probable chorismate pyruvate-lyase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A1K2P0 1.59e-05 46 29 5 158 3 ubiC Probable chorismate pyruvate-lyase Azoarcus sp. (strain BH72)
Q3KIF2 0.000111 44 29 1 116 3 ubiC1 Probable chorismate pyruvate-lyase 1 Pseudomonas fluorescens (strain Pf0-1)
Q1BUR8 0.000738 42 25 6 158 3 ubiC Probable chorismate pyruvate-lyase Burkholderia orbicola (strain AU 1054)
A0K9B9 0.000738 42 25 6 158 3 ubiC Probable chorismate pyruvate-lyase Burkholderia cenocepacia (strain HI2424)
Q63W06 0.001 41 25 4 163 3 ubiC Probable chorismate pyruvate-lyase Burkholderia pseudomallei (strain K96243)
Q62ID2 0.001 41 25 4 163 3 ubiC Probable chorismate pyruvate-lyase Burkholderia mallei (strain ATCC 23344)
Q3JUM4 0.001 41 25 4 163 3 ubiC2 Probable chorismate pyruvate-lyase 2 Burkholderia pseudomallei (strain 1710b)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18595
Feature type CDS
Gene ubiC
Product chorismate lyase
Location 58800 - 59324 (strand: -1)
Length 525 (nucleotides) / 174 (amino acids)

Contig

Accession term accessions NZ_VXKB01000009 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 74461 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2419
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04345 Chorismate lyase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3161 Coenzyme transport and metabolism (H) H 4-hydroxybenzoate synthetase (chorismate-pyruvate lyase)

Kegg Ortholog Annotation(s)

Protein Sequence

METKIIPTPPILWLDNADTIPAIVLDWLVELGSMTRRFEQHCTEVTAAPYCERYISRDALTEEEQMNLPDSARYWLREVVLYGDGIAWLTGRTVVPEETLTGEERQLLQMGNVPLGRYLFTSGCLTRDHIRFGRSEHNWARCSRLRLAGKPLLLTEIFLPESPAYAVSEHHGED

Flanking regions ( +/- flanking 50bp)

ATCTGCAAATACGGGAACAAAAAGCGGATCGACACCACGGAGTTTCATGAGTGGAAACAAAAATAATACCCACGCCGCCGATCCTCTGGCTTGATAATGCGGATACGATCCCCGCAATAGTACTGGATTGGCTGGTAGAATTAGGATCGATGACCCGGCGTTTTGAACAACACTGCACAGAAGTGACGGCAGCGCCGTATTGTGAACGCTATATTTCCCGCGATGCACTGACGGAAGAAGAGCAGATGAATCTGCCCGACAGTGCGCGTTACTGGTTACGGGAAGTGGTGTTGTACGGTGACGGGATTGCCTGGCTGACCGGCAGGACAGTCGTGCCGGAAGAGACGCTGACGGGTGAAGAGCGGCAATTATTGCAGATGGGCAATGTGCCTCTCGGGCGCTATTTATTTACCAGTGGCTGCCTGACCCGGGATCATATCCGCTTCGGTCGGTCAGAACATAACTGGGCGCGCTGCTCGCGGTTGCGGCTTGCCGGTAAGCCATTGTTACTGACTGAAATTTTTTTGCCGGAATCTCCGGCATACGCGGTAAGCGAACATCATGGAGAAGATTAACGTGGAACAAAGCATGGTGCATCGCAAATGGCAGGCATACAGCCGCCTGA