Homologs in group_2242

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16890 FBDBKF_16890 83.8 Morganella morganii S1 fadA acetyl-CoA C-acyltransferase FadA
EHELCC_19540 EHELCC_19540 83.8 Morganella morganii S2 fadA acetyl-CoA C-acyltransferase FadA
NLDBIP_16910 NLDBIP_16910 83.8 Morganella morganii S4 fadA acetyl-CoA C-acyltransferase FadA
LHKJJB_16560 LHKJJB_16560 83.8 Morganella morganii S3 fadA acetyl-CoA C-acyltransferase FadA
HKOGLL_17525 HKOGLL_17525 83.8 Morganella morganii S5 fadA acetyl-CoA C-acyltransferase FadA
PMI_RS17635 PMI_RS17635 65.5 Proteus mirabilis HI4320 fadA acetyl-CoA C-acyltransferase FadA

Distribution of the homologs in the orthogroup group_2242

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2242

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MZ91 0.0 542 67 1 387 3 fadA 3-ketoacyl-CoA thiolase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66FR9 0.0 530 66 1 387 3 fadA 3-ketoacyl-CoA thiolase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR28 0.0 530 66 1 387 3 fadA 3-ketoacyl-CoA thiolase Yersinia pestis (strain Pestoides F)
Q1CNA0 0.0 530 66 1 387 3 fadA 3-ketoacyl-CoA thiolase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAM9 0.0 530 66 1 387 3 fadA 3-ketoacyl-CoA thiolase Yersinia pestis
Q1C2C3 0.0 530 66 1 387 3 fadA 3-ketoacyl-CoA thiolase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDF1 0.0 530 66 1 387 3 fadA 3-ketoacyl-CoA thiolase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JIG3 0.0 525 65 1 387 3 fadA 3-ketoacyl-CoA thiolase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WFX5 0.0 511 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Enterobacter sp. (strain 638)
A8G8D0 0.0 510 64 1 387 3 fadA 3-ketoacyl-CoA thiolase Serratia proteamaculans (strain 568)
B2VFE0 5.85e-179 505 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q32A20 9.06e-179 505 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Shigella dysenteriae serotype 1 (strain Sd197)
A6TGM3 1.09e-178 504 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8A6V0 1.12e-178 504 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia coli O9:H4 (strain HS)
Q8X8J4 1.22e-178 504 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia coli O157:H7
P0A2H7 3.4e-178 503 62 1 387 1 fadA 3-ketoacyl-CoA thiolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2H8 3.4e-178 503 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Salmonella typhi
Q5PKQ3 3.4e-178 503 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7MQM5 3.44e-178 503 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Cronobacter sakazakii (strain ATCC BAA-894)
B7LTZ0 4.73e-178 503 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P21151 4.78e-178 503 63 1 387 1 fadA 3-ketoacyl-CoA thiolase FadA Escherichia coli (strain K12)
Q31UE3 5.33e-178 503 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Shigella boydii serotype 4 (strain Sb227)
Q83PG2 6.71e-178 503 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Shigella flexneri
Q0SZ35 6.71e-178 503 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Shigella flexneri serotype 5b (strain 8401)
A1AI32 1.38e-177 502 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia coli O1:K1 / APEC
Q8FBI3 1.43e-177 502 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3YVC2 1.52e-177 502 63 1 387 3 fadA 3-ketoacyl-CoA thiolase Shigella sonnei (strain Ss046)
Q0TAL1 2.07e-177 501 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q57HM7 3.94e-177 501 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Salmonella choleraesuis (strain SC-B67)
Q1R467 4.45e-177 501 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia coli (strain UTI89 / UPEC)
A8ACZ3 4.83e-177 501 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7ZU50 6.24e-177 500 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q6DAP6 1.2e-176 499 62 1 386 3 fadA 3-ketoacyl-CoA thiolase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5QXH8 1.54e-175 497 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
C6DI66 2.84e-175 496 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6LW07 3.41e-173 491 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Photobacterium profundum (strain SS9)
Q9F0Y6 4.25e-173 491 61 1 387 3 fadA 3-ketoacyl-CoA thiolase Enterobacter cloacae
A4STF3 4.39e-173 491 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Aeromonas salmonicida (strain A449)
A0KEL0 1.78e-172 489 62 1 387 3 fadA 3-ketoacyl-CoA thiolase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A3Q8U3 5.55e-172 488 61 1 386 3 fadA 3-ketoacyl-CoA thiolase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B5FEW7 8.26e-171 485 60 1 386 3 fadA 3-ketoacyl-CoA thiolase Aliivibrio fischeri (strain MJ11)
Q5E8X7 1.64e-170 484 60 1 386 3 fadA 3-ketoacyl-CoA thiolase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4Y1B5 7.3e-169 480 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6WH99 7.3e-169 480 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella baltica (strain OS185)
A3CYJ3 8.42e-169 479 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A5F464 8.79e-169 479 62 1 386 3 fadA 3-ketoacyl-CoA thiolase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KNI0 1.09e-168 479 62 1 386 3 fadA 3-ketoacyl-CoA thiolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q08A40 1.39e-168 479 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella frigidimarina (strain NCIMB 400)
A1S1I7 4.63e-168 478 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q8EKS0 5.17e-168 478 59 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B6EGU1 5.7e-168 478 59 1 386 3 fadA 3-ketoacyl-CoA thiolase Aliivibrio salmonicida (strain LFI1238)
A1RDW3 7.57e-168 477 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella sp. (strain W3-18-1)
Q0I0T4 1.13e-167 477 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella sp. (strain MR-7)
Q0HPB8 4.26e-167 475 59 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella sp. (strain MR-4)
A0KR49 4.26e-167 475 59 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella sp. (strain ANA-3)
Q15ZF4 8.74e-167 474 60 2 387 3 fadA 3-ketoacyl-CoA thiolase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q12TB5 7.15e-166 472 60 1 387 3 fadA 3-ketoacyl-CoA thiolase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8DDK5 3.41e-165 471 60 1 386 3 fadA 3-ketoacyl-CoA thiolase Vibrio vulnificus (strain CMCP6)
Q7MQI0 4.73e-165 470 60 1 386 3 fadA 3-ketoacyl-CoA thiolase Vibrio vulnificus (strain YJ016)
Q6FF69 3.09e-164 468 60 1 383 3 fadA 3-ketoacyl-CoA thiolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q3IJ24 5.21e-164 468 59 1 387 3 fadA 3-ketoacyl-CoA thiolase Pseudoalteromonas translucida (strain TAC 125)
A3M1H9 3.1e-163 466 60 2 385 3 fadA 3-ketoacyl-CoA thiolase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VE46 7.68e-163 464 60 2 385 3 fadA 3-ketoacyl-CoA thiolase Acinetobacter baumannii (strain AYE)
B0VLX5 7.68e-163 464 60 2 385 3 fadA 3-ketoacyl-CoA thiolase Acinetobacter baumannii (strain SDF)
B2I2J8 7.68e-163 464 60 2 385 3 fadA 3-ketoacyl-CoA thiolase Acinetobacter baumannii (strain ACICU)
B7I3P0 7.68e-163 464 60 2 385 3 fadA 3-ketoacyl-CoA thiolase Acinetobacter baumannii (strain AB0057)
B7H1I1 7.68e-163 464 60 2 385 3 fadA 3-ketoacyl-CoA thiolase Acinetobacter baumannii (strain AB307-0294)
Q87TP0 7.8e-162 462 60 1 383 3 fadA 3-ketoacyl-CoA thiolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1Q8K0 3.32e-158 453 56 1 385 3 fadA 3-ketoacyl-CoA thiolase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQC7 4.97e-158 452 56 1 385 3 fadA 3-ketoacyl-CoA thiolase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A5WH98 8.68e-158 452 56 1 385 3 fadA 3-ketoacyl-CoA thiolase Psychrobacter sp. (strain PRwf-1)
Q489W4 1.66e-157 451 57 2 387 3 fadA 3-ketoacyl-CoA thiolase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0VNZ7 3.2e-156 448 56 1 386 3 fadA 3-ketoacyl-CoA thiolase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2SD23 3.54e-154 443 56 1 384 3 fadA 3-ketoacyl-CoA thiolase Hahella chejuensis (strain KCTC 2396)
A1TZR8 3.14e-153 440 56 1 376 3 fadA 3-ketoacyl-CoA thiolase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q48GW4 6.99e-151 434 56 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1QUW9 1.3e-150 434 57 1 384 3 fadA 3-ketoacyl-CoA thiolase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A4VKA4 2.83e-150 433 55 1 383 3 fadA 3-ketoacyl-CoA thiolase Stutzerimonas stutzeri (strain A1501)
P28790 3.71e-150 432 55 1 384 1 fadA 3-ketoacyl-CoA thiolase Pseudomonas fragi
Q4ZRA1 6.14e-150 432 55 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas syringae pv. syringae (strain B728a)
A6VVM8 7.39e-150 432 57 1 384 3 fadA 3-ketoacyl-CoA thiolase Marinomonas sp. (strain MWYL1)
Q87ZB3 7.72e-150 432 55 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q21KB1 2.27e-149 431 55 1 384 3 fadA 3-ketoacyl-CoA thiolase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9HZJ3 5.21e-149 429 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PH7 6.21e-149 429 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V383 6.21e-149 429 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas aeruginosa (strain PA7)
Q93Q11 7.16e-148 427 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas oleovorans
Q3K9D9 7.98e-148 427 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas fluorescens (strain Pf0-1)
A5W6G9 1.16e-147 426 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88L01 1.62e-147 426 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1I7D5 2.28e-147 426 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas entomophila (strain L48)
Q4KFC3 2.65e-147 425 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9R9W0 5.16e-147 424 54 1 384 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas putida
A4XSM9 1.26e-145 421 54 1 383 3 fadA 3-ketoacyl-CoA thiolase Pseudomonas mendocina (strain ymp)
Q43935 2.69e-104 316 45 7 406 3 catF Beta-ketoadipyl-CoA thiolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q43974 8.5e-104 315 45 7 406 1 pcaF Beta-ketoadipyl-CoA thiolase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P0C7L2 1.67e-99 304 44 7 406 1 paaJ 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase Escherichia coli (strain K12)
P0C7L3 3.3e-99 303 44 7 406 3 paaJ Beta-ketoadipyl-CoA thiolase Escherichia coli
O32177 3.57e-97 298 43 4 393 2 fadA 3-ketoacyl-CoA thiolase Bacillus subtilis (strain 168)
P44873 8.46e-94 289 43 7 400 3 atoB Acetyl-CoA acetyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9I6R0 2.6e-90 280 41 8 403 1 pcaF Beta-ketoadipyl-CoA thiolase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q18AR0 3.22e-89 277 40 7 398 1 thlA Acetyl-CoA acetyltransferase Clostridioides difficile (strain 630)
Q5HIU0 7.94e-88 274 41 7 398 3 SACOL0426 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain COL)
Q2G124 2.44e-87 272 40 7 398 3 SAOUHSC_00336 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJQ9 2.44e-87 272 40 7 398 3 SAUSA300_0355 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain USA300)
Q8NY95 4.14e-87 272 40 7 398 3 MW0330 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain MW2)
Q6GCB8 4.14e-87 272 40 7 398 3 SAS0330 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain MSSA476)
Q8CQN7 4.36e-87 272 40 8 399 3 SE_2384 Probable acetyl-CoA acyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HS07 4.36e-87 272 40 8 399 3 SERP0032 Probable acetyl-CoA acyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P45363 4.41e-87 272 39 7 402 3 phaA Acetyl-CoA acetyltransferase Thiocystis violacea
Q6GJW4 5.03e-87 271 40 7 398 3 SAR0351 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain MRSA252)
P45359 3.56e-86 270 39 7 398 1 thlA Acetyl-CoA acetyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8VPF1 7.48e-86 269 40 7 402 1 pcaF Beta-ketoadipyl-CoA thiolase Pseudomonas knackmussii (strain DSM 6978 / CCUG 54928 / LMG 23759 / B13)
Q7A7L2 1.01e-85 268 40 7 398 1 SA0342 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain N315)
Q99WM3 1.01e-85 268 40 7 398 3 SAV0354 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q51956 1.61e-85 268 41 6 404 3 pcaF Beta-ketoadipyl-CoA thiolase Pseudomonas putida
Q2YVF5 2.7e-85 267 40 7 398 3 SAB0304 Probable acetyl-CoA acyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
P14611 4.73e-85 266 39 7 399 1 phaA Acetyl-CoA acetyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0AVM3 9.37e-85 266 40 8 399 1 Swol_1934 Acetyl-CoA acetyltransferase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9ZHI1 1.19e-83 263 41 6 396 3 phaA Acetyl-CoA acetyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P76461 4.06e-83 261 43 6 400 1 atoB Acetyl-CoA acetyltransferase Escherichia coli (strain K12)
P50174 4.69e-83 261 39 7 395 3 phaA Acetyl-CoA acetyltransferase Rhizobium meliloti (strain 1021)
Q8LF48 1.34e-82 262 39 6 393 1 KAT1 3-ketoacyl-CoA thiolase 1, peroxisomal Arabidopsis thaliana
Q9I2A8 6.5e-82 258 40 7 399 1 atoB Acetyl-CoA acetyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q56WD9 6.76e-82 261 39 6 393 1 PED1 3-ketoacyl-CoA thiolase 2, peroxisomal Arabidopsis thaliana
P07097 1.55e-80 255 39 7 394 1 phaA Acetyl-CoA acetyltransferase Shinella zoogloeoides
P45369 3.07e-80 254 38 8 399 3 phaA Acetyl-CoA acetyltransferase Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q46939 4.39e-80 254 40 6 398 3 yqeF Probable acetyl-CoA acetyltransferase Escherichia coli (strain K12)
P09110 7.39e-80 254 41 10 394 1 ACAA1 3-ketoacyl-CoA thiolase, peroxisomal Homo sapiens
Q0KBP1 3.38e-79 251 37 5 403 1 bktB Beta-ketothiolase BktB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8VCH0 5.75e-79 252 41 10 395 1 Acaa1b 3-ketoacyl-CoA thiolase B, peroxisomal Mus musculus
Q921H8 8.84e-79 251 41 10 400 1 Acaa1a 3-ketoacyl-CoA thiolase A, peroxisomal Mus musculus
C8YNG6 1.81e-78 252 38 5 393 1 KAT1 3-ketoacyl CoA thiolase 1, peroxisomal Petunia hybrida
Q570C8 3.22e-78 251 39 7 395 1 KAT5 3-ketoacyl-CoA thiolase 5, peroxisomal Arabidopsis thaliana
P07871 1.35e-77 248 41 10 400 1 Acaa1b 3-ketoacyl-CoA thiolase B, peroxisomal Rattus norvegicus
P54810 1.78e-77 247 38 7 397 3 phaA Acetyl-CoA acetyltransferase Paracoccus denitrificans
P21775 6.75e-77 247 41 10 397 1 Acaa1a 3-ketoacyl-CoA thiolase A, peroxisomal Rattus norvegicus
Q9BWD1 4.66e-76 243 37 8 401 1 ACAT2 Acetyl-CoA acetyltransferase, cytosolic Homo sapiens
I6XHJ3 2.52e-75 242 37 9 401 1 fadA6 Steroid 3-ketoacyl-CoA thiolase FadA6 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O53871 1.4e-74 240 35 7 409 1 fadA Putative acyltransferase Rv0859 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I6XHI4 4.62e-73 236 38 8 396 1 fadA5 Steroid 3-ketoacyl-CoA thiolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P13437 6.41e-73 235 36 6 397 1 Acaa2 3-ketoacyl-CoA thiolase, mitochondrial Rattus norvegicus
P42765 1.22e-71 232 35 6 397 1 ACAA2 3-ketoacyl-CoA thiolase, mitochondrial Homo sapiens
Q5RES5 2.03e-71 231 35 6 397 2 ACAA2 3-ketoacyl-CoA thiolase, mitochondrial Pongo abelii
Q5XI22 2.89e-71 231 37 7 397 1 Acat2 Acetyl-CoA acetyltransferase, cytosolic Rattus norvegicus
Q8BWT1 5.04e-71 231 36 6 397 1 Acaa2 3-ketoacyl-CoA thiolase, mitochondrial Mus musculus
Q3T0R7 1.99e-70 229 35 6 397 2 ACAA2 3-ketoacyl-CoA thiolase, mitochondrial Bos taurus
Q8SVA6 5.08e-70 228 36 8 390 1 FOX3 3-ketoacyl-CoA thiolase, peroxisomal Encephalitozoon cuniculi (strain GB-M1)
Q8CAY6 1.86e-68 224 36 7 397 1 Acat2 Acetyl-CoA acetyltransferase, cytosolic Mus musculus
P33291 4.51e-68 223 37 7 392 3 None 3-ketoacyl-CoA thiolase B, peroxisomal Candida tropicalis
P45855 5.78e-68 223 35 7 398 1 mmgA Acetyl-CoA acetyltransferase Bacillus subtilis (strain 168)
I1RY81 4.59e-65 215 36 9 400 2 ERG10 Acetyl-CoA acetyltransferase ERG10, cytosolic Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P33290 7.79e-65 215 37 7 392 3 None 3-ketoacyl-CoA thiolase A, peroxisomal Candida tropicalis
A0A1D8PH52 1.36e-63 211 35 6 397 2 ERG10 Acetyl-CoA acetyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q9UQW6 6.66e-63 209 35 6 397 2 erg10 Acetyl-CoA acetyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6L8K7 7.48e-63 209 34 8 398 3 PAT1 Acetyl-CoA acetyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q4WLA8 9.08e-62 207 35 11 402 1 erg10A Acetyl-CoA acetyltransferase erg10A, mitochondrial Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0XMC1 9.08e-62 207 35 11 402 1 erg10A Acetyl-CoA acetyltransferase erg10A, mitochondrial Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
P27796 1.06e-61 207 36 10 399 1 POT1 3-ketoacyl-CoA thiolase, peroxisomal Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P10551 1.44e-61 206 34 6 400 1 ERG10 Acetyl-CoA acetyltransferase Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525)
P41338 1.78e-61 206 32 6 400 1 ERG10 Acetyl-CoA acetyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q12598 2.06e-61 206 34 6 400 1 PACTA Acetyl-CoA acetyltransferase IA Candida tropicalis
B2TWV5 3.42e-61 206 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q04677 5.73e-61 204 34 6 400 1 PACTB Acetyl-CoA acetyltransferase IB Candida tropicalis
B7UFZ9 6.82e-61 205 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q4WCL5 1.19e-60 204 34 6 400 1 erg10B Acetyl-CoA acetyltransferase erg10B, cytosolic Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0YA65 1.19e-60 204 34 6 400 1 erg10B Acetyl-CoA acetyltransferase erg10B, cytosolic Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
A8A2L1 1.3e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O9:H4 (strain HS)
B6I6Q5 1.73e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli (strain SE11)
B7M6M3 1.73e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O8 (strain IAI1)
A7ZPF9 1.73e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7N5V3 1.75e-60 204 34 9 427 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P76503 1.93e-60 204 34 9 413 1 fadI 3-ketoacyl-CoA thiolase FadI Escherichia coli (strain K12)
B1X9L5 1.93e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli (strain K12 / DH10B)
C4ZVN3 1.93e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli (strain K12 / MC4100 / BW2952)
B1LME8 2.05e-60 204 34 9 427 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli (strain SMS-3-5 / SECEC)
B7MY17 2.21e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O81 (strain ED1a)
Q8FFG3 2.54e-60 204 34 9 427 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1IXA4 2.88e-60 204 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q31YB6 3.68e-60 203 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Shigella boydii serotype 4 (strain Sb227)
B7LBJ6 3.88e-60 203 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli (strain 55989 / EAEC)
Q1R971 4.22e-60 203 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli (strain UTI89 / UPEC)
Q0TFA5 4.22e-60 203 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ADI9 4.22e-60 203 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O1:K1 / APEC
B7MGV8 4.22e-60 203 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NP25 6.73e-60 203 34 9 427 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q0T2E5 8.15e-60 202 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Shigella flexneri serotype 5b (strain 8401)
A9MJ36 8.77e-60 202 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3YZM1 1.04e-59 202 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Shigella sonnei (strain Ss046)
A8ADP1 1.6e-59 202 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
O46629 1.67e-59 203 33 10 435 2 HADHB Trifunctional enzyme subunit beta, mitochondrial Bos taurus
Q83K95 2.93e-59 201 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Shigella flexneri
B5YXY5 4.78e-59 201 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCN9 4.78e-59 201 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia coli O157:H7
B7LLC9 5.78e-59 200 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A0KK76 1.24e-58 199 34 10 431 3 fadI 3-ketoacyl-CoA thiolase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A0R1Y7 1.64e-58 198 34 6 394 1 MSMEG_4920 Probable acetyl-CoA acetyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A4SMT9 1.87e-58 199 34 10 430 3 fadI 3-ketoacyl-CoA thiolase Aeromonas salmonicida (strain A449)
A4WCW7 2.41e-58 199 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Enterobacter sp. (strain 638)
B4TQC3 4.41e-58 198 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella schwarzengrund (strain CVM19633)
B4SZR1 4.46e-58 198 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella newport (strain SL254)
B5XVW1 4.7e-58 198 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Klebsiella pneumoniae (strain 342)
C0PZX5 5.17e-58 198 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella paratyphi C (strain RKS4594)
B4TCA9 5.74e-58 197 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella heidelberg (strain SL476)
Q8Z4Y9 6.18e-58 197 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella typhi
P55084 6.33e-58 199 32 10 435 1 HADHB Trifunctional enzyme subunit beta, mitochondrial Homo sapiens
Q5R1W7 7.12e-58 198 32 10 435 2 HADHB Trifunctional enzyme subunit beta, mitochondrial Pan troglodytes
Q32DJ3 7.25e-58 197 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Shigella dysenteriae serotype 1 (strain Sd197)
Q9FIK7 7.28e-58 197 34 5 394 1 ACCT1 Acetyl-CoA acetyltransferase 1 Arabidopsis thaliana
Q05493 7.66e-58 197 33 7 394 3 POT1 3-ketoacyl-CoA thiolase, peroxisomal Yarrowia lipolytica (strain CLIB 122 / E 150)
Q57LW5 9.34e-58 197 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella choleraesuis (strain SC-B67)
Q5PCX7 9.64e-58 197 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZNA6 1.26e-57 197 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R3S0 1.43e-57 197 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella enteritidis PT4 (strain P125109)
B5FPN2 1.43e-57 197 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella dublin (strain CT_02021853)
B5EZS0 1.43e-57 197 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella agona (strain SL483)
Q8HXX4 1.52e-57 197 32 10 435 2 HADHB Trifunctional enzyme subunit beta, mitochondrial Macaca fascicularis
A6TC20 2.11e-57 196 34 9 413 3 fadI 3-ketoacyl-CoA thiolase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5BBA0 2.58e-57 196 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella paratyphi A (strain AKU_12601)
Q99JY0 3.04e-57 197 31 9 436 1 Hadhb Trifunctional enzyme subunit beta, mitochondrial Mus musculus
A9N452 3.65e-57 196 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q6GJ93 2.03e-56 192 32 9 401 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus aureus (strain MRSA252)
Q8QZT1 2.97e-56 193 32 7 397 1 Acat1 Acetyl-CoA acetyltransferase, mitochondrial Mus musculus
Q60587 4.18e-56 194 31 9 436 1 Hadhb Trifunctional enzyme subunit beta, mitochondrial Rattus norvegicus
P17764 5.09e-56 192 33 7 397 1 Acat1 Acetyl-CoA acetyltransferase, mitochondrial Rattus norvegicus
Q7A1P9 7.25e-56 191 32 9 401 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus aureus (strain MW2)
Q7A768 7.25e-56 191 32 9 401 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus aureus (strain N315)
Q7A2W9 7.25e-56 191 32 9 401 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9KWK4 7.25e-56 191 32 9 401 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6NU46 7.53e-56 192 32 7 397 2 acat1-a Acetyl-CoA acetyltransferase A, mitochondrial Xenopus laevis
Q6GBR1 9.86e-56 190 32 9 401 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus aureus (strain MSSA476)
P73825 1.96e-55 190 34 8 403 3 phaA Acetyl-CoA acetyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5HIA0 2.43e-55 189 32 9 401 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus aureus (strain COL)
P34255 3.04e-55 191 31 11 430 3 B0303.3 Probable 3-ketoacyl-CoA thiolase Caenorhabditis elegans
A7MH80 4.13e-55 190 33 9 413 3 fadI 3-ketoacyl-CoA thiolase Cronobacter sakazakii (strain ATCC BAA-894)
B1JGG1 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q668V0 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TM83 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pestis (strain Pestoides F)
Q1CHK1 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZD46 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pestis
B2K8J6 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C659 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FGK0 4.4e-55 190 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3IEE3 9.31e-55 189 32 11 418 3 fadI 3-ketoacyl-CoA thiolase Pseudoalteromonas translucida (strain TAC 125)
Q8HXY6 9.45e-55 189 31 7 397 2 ACAT1 Acetyl-CoA acetyltransferase, mitochondrial Macaca fascicularis
P24752 1.15e-54 189 31 7 397 1 ACAT1 Acetyl-CoA acetyltransferase, mitochondrial Homo sapiens
A9R7W9 1.2e-54 189 33 10 401 3 fadI 3-ketoacyl-CoA thiolase Yersinia pestis bv. Antiqua (strain Angola)
Q6AZA0 1.93e-54 188 31 7 397 2 acat1 Acetyl-CoA acetyltransferase, mitochondrial Danio rerio
A1JK23 2.61e-54 188 33 9 399 3 fadI 3-ketoacyl-CoA thiolase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B8CPY7 4.47e-54 187 32 11 417 3 fadI 3-ketoacyl-CoA thiolase Shewanella piezotolerans (strain WP3 / JCM 13877)
B0TL22 6.4e-54 187 31 10 415 3 fadI 3-ketoacyl-CoA thiolase Shewanella halifaxensis (strain HAW-EB4)
B4RTU9 6.96e-54 187 33 10 419 3 fadI 3-ketoacyl-CoA thiolase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A8H5T2 7.81e-54 187 32 11 417 3 fadI 3-ketoacyl-CoA thiolase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
I1RMA2 1.2e-53 186 32 10 405 3 FG05087 Acetyl-CoA acetyltransferase FG05087, mitochondrial Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q86AD9 1.62e-53 186 32 9 401 2 DDB_G0271544 Probable acetyl-CoA acetyltransferase Dictyostelium discoideum
Q15VA3 2.26e-53 186 33 10 417 3 fadI 3-ketoacyl-CoA thiolase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8S4Y1 9.19e-53 183 34 5 376 1 ACCT2 Acetyl-CoA acetyltransferase 2 Arabidopsis thaliana
A9KTW7 1.26e-52 184 31 10 429 3 fadI 3-ketoacyl-CoA thiolase Shewanella baltica (strain OS195)
A3D685 1.26e-52 184 31 10 429 3 fadI 3-ketoacyl-CoA thiolase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EE97 1.26e-52 184 31 10 429 3 fadI 3-ketoacyl-CoA thiolase Shewanella baltica (strain OS223)
A6WQ26 1.74e-52 183 31 10 431 3 fadI 3-ketoacyl-CoA thiolase Shewanella baltica (strain OS185)
Q8CTR0 1.8e-52 182 32 8 400 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A1RI91 1.93e-52 183 31 10 431 3 fadI 3-ketoacyl-CoA thiolase Shewanella sp. (strain W3-18-1)
Q29RZ0 2.22e-52 182 31 7 397 2 ACAT1 Acetyl-CoA acetyltransferase, mitochondrial Bos taurus
Q6GN02 2.79e-52 182 31 7 397 2 acat1-b Acetyl-CoA acetyltransferase B, mitochondrial Xenopus laevis
Q5HRH3 3.49e-52 181 32 8 400 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4Y898 5.64e-52 182 31 11 433 3 fadI 3-ketoacyl-CoA thiolase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q47ZB6 6.46e-52 182 32 9 415 3 fadI 3-ketoacyl-CoA thiolase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q6LTK4 8.58e-52 181 32 10 414 3 fadI 3-ketoacyl-CoA thiolase Photobacterium profundum (strain SS9)
A1S7L7 1.51e-51 181 31 11 419 3 fadI 3-ketoacyl-CoA thiolase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
P46707 2.79e-51 179 33 6 396 3 fadA4 Probable acetyl-CoA acetyltransferase Mycobacterium leprae (strain TN)
Q4L3Q1 2.94e-51 179 35 6 330 3 vraB Putative acetyl-CoA C-acetyltransferase VraB Staphylococcus haemolyticus (strain JCSC1435)
Q5BKN8 5.35e-51 179 31 7 397 2 acat1 Acetyl-CoA acetyltransferase, mitochondrial Xenopus tropicalis
Q7N287 6.17e-51 179 31 11 429 3 fadI 3-ketoacyl-CoA thiolase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1KKT1 6.57e-51 179 31 12 419 3 fadI 3-ketoacyl-CoA thiolase Shewanella woodyi (strain ATCC 51908 / MS32)
P9WG68 1.07e-50 177 34 6 392 3 fadA4 Probable acetyl-CoA acetyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66927 1.07e-50 177 34 6 392 3 fadA4 Probable acetyl-CoA acetyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q07ZP7 1.55e-50 178 31 10 413 3 fadI 3-ketoacyl-CoA thiolase Shewanella frigidimarina (strain NCIMB 400)
Q5QXN5 2.19e-50 178 31 9 417 3 fadI 3-ketoacyl-CoA thiolase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A8GH87 3.27e-50 177 31 9 413 3 fadI 3-ketoacyl-CoA thiolase Serratia proteamaculans (strain 568)
Q22100 3.99e-50 176 31 7 393 1 kat-1 Acetyl-CoA acetyltransferase homolog, mitochondrial Caenorhabditis elegans
P9WG69 4.05e-50 176 34 6 396 1 fadA4 Probable acetyl-CoA acetyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q0HWN4 1.23e-49 176 30 10 413 3 fadI 3-ketoacyl-CoA thiolase Shewanella sp. (strain MR-7)
Q0HKD2 1.23e-49 176 30 10 413 3 fadI 3-ketoacyl-CoA thiolase Shewanella sp. (strain MR-4)
A0KV75 1.23e-49 176 30 10 413 3 fadI 3-ketoacyl-CoA thiolase Shewanella sp. (strain ANA-3)
O07618 1.45e-49 174 33 9 366 2 yhfS Putative acetyl-CoA C-acetyltransferase YhfS Bacillus subtilis (strain 168)
A8FTR6 1.46e-49 176 31 11 417 3 fadI 3-ketoacyl-CoA thiolase Shewanella sediminis (strain HAW-EB3)
A5F2P1 1.57e-49 176 32 10 414 3 fadI 3-ketoacyl-CoA thiolase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A3QFP4 2.34e-49 175 30 10 413 3 fadI 3-ketoacyl-CoA thiolase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q9KT59 2.51e-49 175 32 10 414 3 fadI 3-ketoacyl-CoA thiolase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ECP6 3.23e-49 175 31 10 415 3 fadI 3-ketoacyl-CoA thiolase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C6DAL8 3.99e-49 174 33 11 400 3 fadI 3-ketoacyl-CoA thiolase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q12P12 1.26e-48 173 31 10 413 3 fadI 3-ketoacyl-CoA thiolase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q6D2L6 1.58e-48 173 32 11 400 3 fadI 3-ketoacyl-CoA thiolase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7MIS4 2.48e-48 172 32 11 414 3 fadI 3-ketoacyl-CoA thiolase Vibrio vulnificus (strain YJ016)
Q87MM2 3.16e-48 172 32 10 416 3 fadI 3-ketoacyl-CoA thiolase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B2VJ10 5.55e-48 171 31 9 399 3 fadI 3-ketoacyl-CoA thiolase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8DB48 1.04e-47 171 32 11 414 3 fadI 3-ketoacyl-CoA thiolase Vibrio vulnificus (strain CMCP6)
B5FGB5 1.24e-46 168 30 10 415 3 fadI 3-ketoacyl-CoA thiolase Aliivibrio fischeri (strain MJ11)
Q5E3U0 7.39e-46 166 29 10 415 3 fadI 3-ketoacyl-CoA thiolase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P11915 4.76e-12 70 26 12 298 1 Scp2 Sterol carrier protein 2 Rattus norvegicus
O62742 1.24e-11 69 27 12 298 1 SCP2 Sterol carrier protein 2 Oryctolagus cuniculus
P32020 2.59e-11 68 26 12 298 1 Scp2 Sterol carrier protein 2 Mus musculus
Q07598 1.17e-09 63 25 12 298 2 SCP2 Sterol carrier protein 2 (Fragment) Gallus gallus
P22307 2.73e-09 62 27 13 300 1 SCP2 Sterol carrier protein 2 Homo sapiens
P45362 5.84e-09 56 37 2 98 3 thi Acetyl-CoA acetyltransferase (Fragment) Clostridioides difficile
P07857 8.77e-09 60 26 11 298 1 SCP2 Sterol carrier protein 2 Bos taurus
G5EDP2 1.98e-06 53 23 16 304 1 daf-22 Non-specific lipid-transfer protein-like 2 Caenorhabditis elegans
O26884 2.12e-05 49 24 11 373 4 MTH_793 Uncharacterized protein MTH_793 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A0A481WNP4 0.000557 46 29 2 94 3 traA Hybrid PKS-NRPS synthetase traA Penicillium crustosum

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18360
Feature type CDS
Gene fadA
Product acetyl-CoA C-acyltransferase FadA
Location 6750 - 7916 (strand: 1)
Length 1167 (nucleotides) / 388 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000009
Length 74461 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2242
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00108 Thiolase, N-terminal domain
PF02803 Thiolase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0183 Lipid transport and metabolism (I) I Acetyl-CoA acetyltransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MEKVMIVDGLRTSMGRSKNGIFRHVRAENLSAEVMNAIINRNNINAEDIDDIIWGCVQQTGEQGFNIARNAALLTDIPQHVPAVTVNRLCGSSMQALHDAARLIQTGDGRLALAGGVEHMGHIPMTQGIDYNPASAIHTAKASGIMGLTAEVLARQFSISRQAQDEFALRSHQRAAQAFREQKFSREIHPVSGHNPAGIPIAAVRDETVRENSNLAELAALRPVFDPVNGSVTAGNSSAISDGASVMLLAGEHYAQEQGLTPRAVVRSMSVVGCEPALMGYGPVPATHLALKKAGLTLDDIAVIELNEAFSAQALACLKGLGLAENYDDRVNLHGGAIALGHPLGCSGTRIITSLLTVMEQQDAQFGLATMCIGFGQGIATVIERLPG

Flanking regions ( +/- flanking 50bp)

CTATTATCCGCAGCCGGGTAGTAATCCGATTGAGAAACAGTGAGGTTTATATGGAAAAAGTCATGATAGTTGATGGTCTCCGCACCTCAATGGGGCGTTCAAAAAACGGAATTTTCCGGCATGTACGGGCAGAAAACCTCTCCGCTGAGGTGATGAATGCCATCATAAACCGCAATAATATCAATGCAGAAGATATCGATGACATTATCTGGGGCTGTGTACAGCAAACGGGGGAACAAGGTTTTAATATCGCCCGCAATGCTGCATTACTGACCGATATCCCGCAACATGTTCCTGCGGTAACAGTTAACCGACTGTGCGGCTCGTCCATGCAGGCACTGCATGATGCCGCACGGCTGATTCAGACTGGTGATGGTCGGTTAGCATTAGCCGGGGGGGTGGAACATATGGGTCATATCCCGATGACGCAGGGTATTGATTATAATCCCGCCTCGGCAATTCATACGGCTAAAGCATCCGGTATTATGGGACTGACAGCCGAAGTTCTGGCACGGCAATTCTCGATAAGCCGGCAGGCTCAGGATGAGTTTGCACTACGCTCACATCAGCGGGCTGCCCAGGCTTTCAGAGAACAAAAATTTTCCCGTGAAATTCATCCGGTATCCGGACATAACCCGGCGGGCATACCAATCGCCGCCGTGCGGGATGAAACCGTCCGCGAAAACAGTAATCTTGCCGAACTCGCCGCACTACGTCCGGTATTCGACCCGGTAAACGGCAGTGTGACGGCTGGTAATTCATCAGCAATCTCTGATGGTGCATCCGTTATGCTGCTTGCCGGTGAGCACTACGCACAAGAACAGGGATTAACACCCCGTGCAGTAGTCAGATCAATGAGCGTTGTCGGTTGTGAACCGGCGCTGATGGGATATGGTCCGGTTCCGGCGACACATCTTGCGCTGAAAAAAGCCGGACTGACACTGGATGATATTGCTGTCATTGAACTGAATGAAGCCTTTTCCGCACAAGCACTTGCCTGTCTGAAAGGACTCGGACTGGCAGAGAACTATGATGACAGAGTTAATCTTCACGGCGGGGCTATTGCACTCGGGCACCCGCTGGGCTGCTCCGGTACACGGATTATCACCTCACTGCTGACGGTCATGGAACAACAGGATGCGCAGTTCGGCCTGGCAACCATGTGTATTGGCTTCGGTCAGGGGATAGCGACCGTAATCGAACGACTCCCCGGCTGACAAGCAGACCGGAAACAAAAACGACCCGCCACAGTACAATGTGGTGAGTC