Homologs in group_4178

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4178

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4178

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16730
Feature type CDS
Gene tssE
Product type VI secretion system baseplate subunit TssE
Location 168931 - 169359 (strand: -1)
Length 429 (nucleotides) / 142 (amino acids)

Contig

Accession term accessions NZ_VXKB01000006 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_4178
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF04965 Baseplate wedge protein gp25

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3518 Intracellular trafficking, secretion, and vesicular transport (U) U Predicted component of the type VI protein secretion system

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11905 type VI secretion system protein - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG049292 type VI secretion system baseplate subunit TssE VF0784 Effector delivery system

Protein Sequence

MSQPSLYEMVTGYFAGGLPVDSVAEDEQVILSVLDNIRRILNSRAGTLSHLPDYGLPDMSKLLQGLPGTAHGLMQVLSATLLKYEPRIKSVSLVLLPPGEFGSLSYALEAELHEQGLVRYGTEFVPDGRIMIHHLKTQHFVS

Flanking regions ( +/- flanking 50bp)

TTGAACTGTCAGAAAACACACTGTCACTTATTCCGCTCAAGAGGTAAATCATGTCACAACCTTCACTCTATGAAATGGTGACCGGCTATTTTGCCGGCGGTCTGCCGGTGGACAGTGTCGCAGAAGATGAACAGGTGATCCTGTCTGTCCTGGATAATATCCGCCGTATTCTTAACTCGCGGGCAGGAACATTGAGCCATCTTCCGGATTATGGTTTGCCGGACATGAGCAAATTATTGCAGGGGCTTCCCGGCACCGCACATGGTCTGATGCAGGTTTTATCTGCCACATTGCTGAAATATGAACCGAGAATCAAATCTGTTTCGCTGGTCTTATTGCCACCCGGCGAATTTGGTTCACTGAGCTATGCACTGGAAGCGGAACTGCATGAACAGGGGCTGGTGCGCTACGGAACGGAATTTGTTCCTGACGGGCGGATAATGATCCACCATCTGAAAACACAACATTTTGTTTCCTGACGTATGTTATTCAAATCCTGATTAAACATGATTGAGGTTATTGTGAAAGC