Homologs in group_1222

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06670 FBDBKF_06670 98.0 Morganella morganii S1 - Urease subunit gamma
EHELCC_09715 EHELCC_09715 98.0 Morganella morganii S2 - Urease subunit gamma
NLDBIP_10095 NLDBIP_10095 98.0 Morganella morganii S4 - Urease subunit gamma
LHKJJB_07660 LHKJJB_07660 98.0 Morganella morganii S3 - Urease subunit gamma
HKOGLL_07210 HKOGLL_07210 98.0 Morganella morganii S5 - Urease subunit gamma
PMI_RS18325 PMI_RS18325 56.0 Proteus mirabilis HI4320 ureA urease subunit gamma

Distribution of the homologs in the orthogroup group_1222

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1222

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6UR35 9.86e-58 175 85 0 100 3 ureA Urease subunit gamma Yersinia rohdei
Q6UR86 3.64e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia aldovae
B1JR69 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P69995 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TL34 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pestis (strain Pestoides F)
Q1CKK1 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pestis bv. Antiqua (strain Nepal516)
P69994 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pestis
B2KAA6 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5B5 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFN0 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6UR44 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia mollaretii
Q6UR53 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia kristensenii
Q6UR62 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia intermedia
Q6UR70 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia frederiksenii
A1JKD7 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6UR78 3.68e-57 174 84 0 100 3 ureA Urease subunit gamma Yersinia bercovieri
P31496 4.75e-56 171 83 0 100 3 ureA Urease subunit gamma Yersinia enterocolitica
C5BDC2 1.59e-55 170 83 0 100 3 ureA Urease subunit gamma Edwardsiella ictaluri (strain 93-146)
Q7N4Y9 1.5e-51 160 76 0 100 3 ureA Urease subunit gamma Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C1D5Z6 2.84e-49 154 72 0 100 3 ureA Urease subunit gamma Laribacter hongkongensis (strain HLHK9)
Q9RHM6 3.36e-43 139 63 0 100 1 ureA Urease subunit gamma Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QA21 3.36e-43 139 63 0 100 3 ureA Urease subunit gamma Corynebacterium glutamicum (strain R)
A1VKW6 3.59e-43 139 64 0 99 3 ureA Urease subunit gamma Polaromonas naphthalenivorans (strain CJ2)
Q07399 4.94e-43 138 64 0 100 1 ureA Urease subunit gamma Bacillus sp. (strain TB-90)
Q12DU1 2.53e-42 136 63 0 99 3 ureA Urease subunit gamma Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q5KYL9 3.07e-42 136 65 0 100 3 ureA Urease subunit gamma Geobacillus kaustophilus (strain HTA426)
C5CXZ7 3.55e-42 136 62 0 99 3 ureA Urease subunit gamma Variovorax paradoxus (strain S110)
B3R3Z9 4.78e-42 135 62 0 99 3 ureA Urease subunit gamma Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q473R2 5.57e-42 135 63 0 99 3 ureA Urease subunit gamma Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LPT2 6.42e-42 135 63 0 99 3 ureA Urease subunit gamma Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2Y9M9 7.57e-42 135 64 0 99 3 ureA Urease subunit gamma Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1WIM6 8.92e-42 135 61 0 99 3 ureA Urease subunit gamma Verminephrobacter eiseniae (strain EF01-2)
B2T0P7 8.92e-42 135 63 0 99 3 ureA Urease subunit gamma Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A9AF70 1.01e-41 135 64 0 99 3 ureA Urease subunit gamma Burkholderia multivorans (strain ATCC 17616 / 249)
B2JF65 1.02e-41 135 64 0 99 3 ureA Urease subunit gamma Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A9BUC7 1.04e-41 135 62 0 99 3 ureA Urease subunit gamma Delftia acidovorans (strain DSM 14801 / SPH-1)
Q1H0F0 1.31e-41 135 63 0 99 3 ureA Urease subunit gamma Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q144E2 1.38e-41 134 63 0 99 3 ureA Urease subunit gamma Paraburkholderia xenovorans (strain LB400)
B2U7N4 1.46e-41 134 62 0 99 3 ureA Urease subunit gamma Ralstonia pickettii (strain 12J)
Q8XXS8 3.18e-41 134 61 0 99 3 ureA Urease subunit gamma Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
O30334 3.18e-41 134 62 0 99 3 ureA Urease subunit gamma Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1KBB7 4.05e-41 133 60 0 99 3 ureA Urease subunit gamma Azoarcus sp. (strain BH72)
A4JC44 4.62e-41 133 63 0 99 3 ureA Urease subunit gamma Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BYH0 4.62e-41 133 63 0 99 3 ureA Urease subunit gamma Burkholderia orbicola (strain AU 1054)
Q39IW1 4.62e-41 133 63 0 99 3 ureA Urease subunit gamma Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BHN3 4.62e-41 133 63 0 99 3 ureA Urease subunit gamma Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A0K578 4.62e-41 133 63 0 99 3 ureA Urease subunit gamma Burkholderia cenocepacia (strain HI2424)
B1YUG1 4.62e-41 133 63 0 99 3 ureA Urease subunit gamma Burkholderia ambifaria (strain MC40-6)
Q47G53 4.67e-41 133 60 0 99 3 ureA Urease subunit gamma Dechloromonas aromatica (strain RCB)
Q02943 5.51e-41 133 62 0 99 1 ureA Urease subunit gamma Klebsiella pneumoniae
Q8YQZ3 5.95e-41 133 62 0 100 3 ureA Urease subunit gamma Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B1JX31 6.56e-41 133 62 0 99 3 ureA Urease subunit gamma Burkholderia orbicola (strain MC0-3)
Q8FZW4 7.24e-41 133 60 0 99 3 ureA2 Urease subunit gamma 2 Brucella suis biovar 1 (strain 1330)
Q8YHZ6 7.24e-41 133 60 0 99 3 ureA2 Urease subunit gamma 2 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57CF0 7.24e-41 133 60 0 99 3 ureA2 Urease subunit gamma 2 Brucella abortus biovar 1 (strain 9-941)
Q2YQE0 7.24e-41 133 60 0 99 1 ureA2 Urease subunit gamma 2 Brucella abortus (strain 2308)
A6TE40 7.32e-41 133 62 0 99 3 ureA Urease subunit gamma Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XU29 7.32e-41 133 62 0 99 3 ureA Urease subunit gamma Klebsiella pneumoniae (strain 342)
P18316 7.32e-41 133 62 0 99 1 ureA Urease subunit gamma Klebsiella aerogenes
Q2SYF5 7.41e-41 133 62 0 99 3 ureA Urease subunit gamma Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B0C791 8.45e-41 132 60 0 99 3 ureA Urease subunit gamma Acaryochloris marina (strain MBIC 11017)
B8HA05 9.12e-41 132 63 0 100 3 ureA Urease subunit gamma Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A3DGG0 9.96e-41 132 59 0 100 3 ureA Urease subunit gamma Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q3M709 1.03e-40 132 62 0 100 3 ureA Urease subunit gamma Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B4ECC5 1.34e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A1TSZ3 1.37e-40 132 62 0 99 3 ureA Urease subunit gamma Paracidovorax citrulli (strain AAC00-1)
Q63RL5 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia pseudomallei (strain K96243)
A3NCL5 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia pseudomallei (strain 668)
Q3JPJ8 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia pseudomallei (strain 1710b)
A3NYC7 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia pseudomallei (strain 1106a)
A1V1G8 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia mallei (strain SAVP1)
Q62HS2 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia mallei (strain ATCC 23344)
A2S998 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia mallei (strain NCTC 10229)
A3MMV0 1.49e-40 132 62 0 99 3 ureA Urease subunit gamma Burkholderia mallei (strain NCTC 10247)
A4SY47 1.51e-40 132 60 0 99 3 ureA Urease subunit gamma Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1VHT0 1.58e-40 132 65 0 100 3 ureA Urease subunit gamma Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q0VKX9 1.76e-40 132 63 0 99 3 ureA Urease subunit gamma Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A2SDJ2 2.08e-40 132 62 0 99 3 ureA Urease subunit gamma Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q83U21 2.29e-40 131 63 0 100 3 ureA Urease subunit gamma Streptococcus thermophilus
Q03ME5 2.29e-40 131 63 0 100 3 ureA Urease subunit gamma Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M609 2.29e-40 131 63 0 100 3 ureA Urease subunit gamma Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1G8 2.29e-40 131 63 0 100 3 ureA Urease subunit gamma Streptococcus thermophilus (strain CNRZ 1066)
Q55053 2.29e-40 131 63 0 100 1 ureA Urease subunit gamma Streptococcus salivarius (strain 57.I)
A4WEJ3 2.88e-40 131 62 0 99 3 ureA Urease subunit gamma Enterobacter sp. (strain 638)
B2IT64 4.28e-40 131 60 0 100 3 ureA Urease subunit gamma Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B8HW52 4.93e-40 130 59 0 100 3 ureA Urease subunit gamma Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B1ZP08 6.14e-40 130 62 0 100 3 ureA Urease subunit gamma Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
P73796 6.35e-40 130 60 0 100 3 ureA Urease subunit gamma Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q21SZ5 7.57e-40 130 58 0 99 3 ureA Urease subunit gamma Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P0A4U1 1.1e-39 130 59 0 99 3 ureA Urease subunit gamma Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4U0 1.1e-39 130 59 0 99 3 ureA Urease subunit gamma Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A8APU8 1.49e-39 129 61 0 99 3 ureA Urease subunit gamma Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2SDQ3 1.54e-39 129 59 0 99 3 ureA Urease subunit gamma Hahella chejuensis (strain KCTC 2396)
B2GI08 1.61e-39 129 59 0 100 3 ureA Urease subunit gamma Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q7VUD0 1.63e-39 129 58 0 99 3 ureA Urease subunit gamma Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A1R1C3 1.99e-39 129 62 0 100 3 ureA Urease subunit gamma Paenarthrobacter aurescens (strain TC1)
Q826S1 2.17e-39 129 61 0 99 3 ureA Urease subunit gamma Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B7K906 2.39e-39 129 60 0 100 3 ureA Urease subunit gamma Gloeothece citriformis (strain PCC 7424)
Q1QC34 2.73e-39 129 59 0 99 3 ureA2 Urease subunit gamma 2 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q8DK85 4.28e-39 128 61 0 100 3 ureA Urease subunit gamma Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A0JRH2 4.57e-39 128 61 0 100 3 ureA Urease subunit gamma Arthrobacter sp. (strain FB24)
Q117Z9 5.61e-39 128 58 0 99 3 ureA Urease subunit gamma Trichodesmium erythraeum (strain IMS101)
B0JTP1 5.69e-39 128 56 0 99 3 ureA Urease subunit gamma Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B1Y3V4 6.93e-39 128 57 0 99 3 ureA Urease subunit gamma Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B1W5G7 7.48e-39 128 60 0 99 3 ureA Urease subunit gamma Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P94667 1.2e-38 127 63 0 100 3 ureA Urease subunit gamma Clostridium perfringens
Q0BQ42 1.41e-38 127 61 0 100 3 ureA Urease subunit gamma Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B4RSX7 1.74e-38 127 61 0 99 3 ureA Urease subunit gamma Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q87VP4 1.86e-38 127 60 0 99 3 ureA Urease subunit gamma Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KIS8 1.94e-38 127 60 0 99 3 ureA Urease subunit gamma Pseudomonas fluorescens (strain Pf0-1)
Q1QV51 2.44e-38 126 58 0 99 3 ureA Urease subunit gamma Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A8G4K7 2.55e-38 126 53 0 99 3 ureA Urease subunit gamma Prochlorococcus marinus (strain MIT 9215)
Q8FQX4 2.98e-38 126 58 0 100 3 ureA Urease subunit gamma Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
C4LF65 3.01e-38 126 57 0 99 3 ureA Urease subunit gamma Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A9AZE8 3.11e-38 126 62 0 100 3 ureA Urease subunit gamma Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q2JJ72 3.66e-38 126 57 0 100 3 ureA Urease subunit gamma Synechococcus sp. (strain JA-2-3B'a(2-13))
Q31B51 4.51e-38 125 51 0 99 3 ureA Urease subunit gamma Prochlorococcus marinus (strain MIT 9312)
Q9Z395 6.33e-38 125 61 0 100 3 ureA Urease subunit gamma Actinomyces naeslundii
C3K5A5 7e-38 125 58 0 99 3 ureA Urease subunit gamma Pseudomonas fluorescens (strain SBW25)
A4VQU9 7.15e-38 125 59 0 99 3 ureA Urease subunit gamma Stutzerimonas stutzeri (strain A1501)
B0TT69 9.3e-38 125 58 0 99 3 ureA Urease subunit gamma Shewanella halifaxensis (strain HAW-EB4)
Q02FF4 9.3e-38 125 57 0 99 3 ureA Urease subunit gamma Pseudomonas aeruginosa (strain UCBPP-PA14)
A6VCX2 9.3e-38 125 57 0 99 3 ureA Urease subunit gamma Pseudomonas aeruginosa (strain PA7)
Q4ZN10 9.51e-38 125 59 0 99 3 ureA Urease subunit gamma Pseudomonas syringae pv. syringae (strain B728a)
Q48DF0 9.51e-38 125 59 0 99 3 ureA Urease subunit gamma Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1SYX9 1.02e-37 125 59 0 99 3 ureA Urease subunit gamma Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q161T2 1.03e-37 125 60 0 100 3 ureA Urease subunit gamma Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A4XQ47 1.18e-37 125 58 0 99 3 ureA Urease subunit gamma Pseudomonas mendocina (strain ymp)
Q9L642 1.22e-37 125 52 0 99 1 ureA Urease subunit gamma Prochlorococcus marinus subsp. pastoris (strain PCC 9511)
Q7V1B4 1.22e-37 125 52 0 99 3 ureA Urease subunit gamma Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
C6AR50 1.63e-37 124 55 0 99 3 ureA Urease subunit gamma Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q733J4 1.63e-37 124 55 0 99 3 ureA Urease subunit gamma Bacillus cereus (strain ATCC 10987 / NRS 248)
A3PCN9 2.14e-37 124 52 0 99 3 ureA Urease subunit gamma Prochlorococcus marinus (strain MIT 9301)
Q9FAS7 2.31e-37 124 55 0 99 2 ureA Urease subunit gamma Vibrio parahaemolyticus
Q9HUU8 2.31e-37 124 57 0 99 3 ureA Urease subunit gamma Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V1S8 2.31e-37 124 57 0 99 3 ureA Urease subunit gamma Pseudomonas aeruginosa (strain LESB58)
B1XLM3 2.49e-37 124 58 0 100 3 ureA Urease subunit gamma Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q3J768 2.55e-37 124 57 0 99 3 ureA Urease subunit gamma Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A2BQW6 2.97e-37 124 51 0 99 3 ureA Urease subunit gamma Prochlorococcus marinus (strain AS9601)
P26931 3.35e-37 124 59 0 100 3 ureA Urease subunit gamma Limosilactobacillus fermentum
A5FAD3 4e-37 123 55 0 100 3 ureA Urease subunit gamma Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q4KJ06 4.04e-37 123 57 0 99 3 ureA Urease subunit gamma Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1HZE2 4.31e-37 123 58 0 100 3 ureA Urease subunit gamma Lysinibacillus sphaericus (strain C3-41)
B5FBC8 4.66e-37 123 56 0 99 3 ureA Urease subunit gamma Aliivibrio fischeri (strain MJ11)
Q5E726 4.66e-37 123 56 0 99 3 ureA Urease subunit gamma Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q3IH70 4.81e-37 123 56 0 99 3 ureA Urease subunit gamma Pseudoalteromonas translucida (strain TAC 125)
C5C8U1 4.97e-37 123 57 0 100 3 ureA Urease subunit gamma Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q03282 6.91e-37 123 56 0 99 2 ureA Urease subunit gamma Escherichia coli
P41022 6.99e-37 123 60 0 99 1 ureA Urease subunit gamma Sporosarcina pasteurii
Q0ACA0 7.8e-37 122 56 0 100 3 ureA Urease subunit gamma Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B0VSC2 8.99e-37 122 59 0 99 3 ureA Urease subunit gamma Acinetobacter baumannii (strain SDF)
Q9FCD1 1.08e-36 122 57 0 99 3 ureA Urease subunit gamma Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B0V9P7 1.08e-36 122 59 0 99 3 ureA Urease subunit gamma Acinetobacter baumannii (strain AYE)
A3M3F0 1.08e-36 122 59 0 99 3 ureA Urease subunit gamma Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HVR8 1.08e-36 122 59 0 99 3 ureA Urease subunit gamma Acinetobacter baumannii (strain ACICU)
B7I8T3 1.08e-36 122 59 0 99 3 ureA Urease subunit gamma Acinetobacter baumannii (strain AB0057)
B7GXU5 1.08e-36 122 59 0 99 3 ureA Urease subunit gamma Acinetobacter baumannii (strain AB307-0294)
P17088 1.12e-36 122 56 0 99 1 ureA Urease subunit gamma Proteus mirabilis (strain HI4320)
Q46IY5 1.29e-36 122 56 0 99 3 ureA Urease subunit gamma Prochlorococcus marinus (strain NATL2A)
B9DLX8 1.85e-36 122 54 0 99 3 ureA Urease subunit gamma Staphylococcus carnosus (strain TM300)
Q0I658 1.91e-36 122 55 0 100 3 ureA Urease subunit gamma Synechococcus sp. (strain CC9311)
Q1QCE2 2.26e-36 121 54 0 99 3 ureA1 Urease subunit gamma 1 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A9KJS1 2.28e-36 121 57 0 100 3 ureA Urease subunit gamma Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q6FD85 2.33e-36 121 56 0 99 3 ureA Urease subunit gamma Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A0L6F0 2.78e-36 121 56 0 100 3 ureA Urease subunit gamma Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A6VTV6 2.81e-36 121 58 0 99 3 ureA Urease subunit gamma Marinomonas sp. (strain MWYL1)
A0PSG4 3.82e-36 121 58 0 100 3 ureA Urease subunit gamma Mycobacterium ulcerans (strain Agy99)
Q89UG3 3.95e-36 121 59 0 100 3 ureA Urease subunit gamma Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5LSQ4 5.66e-36 120 57 0 100 3 ureA Urease subunit gamma Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A2CDZ9 7.05e-36 120 54 0 100 3 ureA Urease subunit gamma Prochlorococcus marinus (strain MIT 9303)
O87400 8.78e-36 120 53 0 100 1 ureA Urease subunit gamma Synechococcus sp. (strain WH7805)
A2C4S0 1.07e-35 120 55 0 100 3 ureA Urease subunit gamma Prochlorococcus marinus (strain NATL1A)
C1DNK6 1.13e-35 120 56 0 99 3 ureA Urease subunit gamma Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P42887 1.33e-35 119 58 0 100 3 ureA Urease subunit gamma Rhizobium meliloti (strain 1021)
Q9KG61 1.57e-35 119 53 0 100 3 ureA Urease subunit gamma Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B8EPV1 1.95e-35 119 58 0 100 3 ureA Urease subunit gamma Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A6UC40 2.02e-35 119 57 0 100 3 ureA Urease subunit gamma Sinorhizobium medicae (strain WSM419)
C3MGX6 2.02e-35 119 57 0 100 3 ureA Urease subunit gamma Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7V3V4 2.18e-35 119 53 0 100 3 ureA Urease subunit gamma Prochlorococcus marinus (strain MIT 9313)
Q8UCS6 2.66e-35 119 57 0 100 3 ureA Urease subunit gamma Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4A0J3 2.8e-35 119 55 0 99 1 ureA Urease subunit gamma Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C1AXZ0 2.9e-35 119 57 0 99 3 ureA Urease subunit gamma Rhodococcus opacus (strain B4)
B9J8M6 3.98e-35 118 58 0 100 3 ureA Urease subunit gamma Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q5YWS0 4.16e-35 118 57 0 99 3 ureA Urease subunit gamma Nocardia farcinica (strain IFM 10152)
A1T9N6 4.3e-35 118 57 0 99 3 ureA Urease subunit gamma Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8RPY7 4.49e-35 118 58 0 100 2 ureA Urease subunit gamma Rhizobium leguminosarum bv. viciae
Q1GJP6 4.96e-35 118 56 0 100 3 ureA Urease subunit gamma Ruegeria sp. (strain TM1040)
Q2JES4 4.96e-35 118 58 0 99 3 ureA Urease subunit gamma Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
P42875 5.12e-35 118 55 0 99 1 ureA Urease subunit gamma Staphylococcus xylosus
P16124 5.12e-35 118 52 0 99 3 ureA Urease subunit gamma Proteus hauseri
B0BRU4 6.59e-35 118 55 0 100 3 ureA Urease subunit gamma Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2L5 6.59e-35 118 55 0 100 3 ureA Urease subunit gamma Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2R6 6.59e-35 118 55 0 100 3 ureA Urease subunit gamma Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3AGD2 7.04e-35 117 54 0 100 3 ureA Urease subunit gamma Synechococcus sp. (strain CC9605)
Q0S4S9 7.12e-35 117 56 0 99 3 ureA Urease subunit gamma Rhodococcus jostii (strain RHA1)
Q11EW7 8.48e-35 117 59 0 100 3 ureA Urease subunit gamma Chelativorans sp. (strain BNC1)
B5YUX1 8.96e-35 117 59 0 99 3 ureA Urease subunit gamma Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAG2 8.96e-35 117 59 0 99 3 ureA1 Urease subunit gamma Escherichia coli O157:H7
Q07K70 1.09e-34 117 54 0 100 3 ureA Urease subunit gamma Rhodopseudomonas palustris (strain BisA53)
Q2K512 1.18e-34 117 57 0 100 3 ureA Urease subunit gamma Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q7U3I5 1.26e-34 117 54 0 100 3 ureA Urease subunit gamma Parasynechococcus marenigrum (strain WH8102)
Q3AVR3 1.33e-34 117 54 0 100 3 ureA Urease subunit gamma Synechococcus sp. (strain CC9902)
B9JR86 1.57e-34 117 56 0 100 3 ureA Urease subunit gamma Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q98CY3 1.58e-34 117 57 0 100 3 ureA Urease subunit gamma Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q133L2 2.2e-34 116 55 0 100 3 ureA Urease subunit gamma Rhodopseudomonas palustris (strain BisB5)
Q8YF71 2.32e-34 116 56 0 100 3 ureA1 Urease subunit gamma 1 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0C121 2.32e-34 116 56 0 100 3 ureA1 Urease subunit gamma 1 Brucella abortus biovar 1 (strain 9-941)
Q2YPD7 2.32e-34 116 56 0 100 1 ureA1 Urease subunit gamma 1 Brucella abortus (strain 2308)
Q4QN07 2.65e-34 116 55 0 100 3 ureA Urease subunit gamma Haemophilus influenzae (strain 86-028NP)
C4LIA9 3.01e-34 116 54 0 100 3 ureA Urease subunit gamma Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q8G2Q0 3.09e-34 116 56 0 100 1 ureA1 Urease subunit gamma 1 Brucella suis biovar 1 (strain 1330)
B5ZMP5 3.23e-34 116 57 0 100 3 ureA Urease subunit gamma Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MCV5 3.23e-34 116 57 0 100 3 ureA Urease subunit gamma Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B3PXB8 3.23e-34 116 57 0 100 3 ureA Urease subunit gamma Rhizobium etli (strain CIAT 652)
Q9RYJ3 3.95e-34 120 58 0 100 3 ureAB Urease subunit gamma/beta Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q0RQR8 4.68e-34 115 55 0 99 3 ureA Urease subunit gamma Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A5U9V4 6.16e-34 115 54 0 100 3 ureA Urease subunit gamma Haemophilus influenzae (strain PittEE)
P75030 7.21e-34 115 55 0 99 1 ureA Urease subunit gamma Bacillus subtilis (strain 168)
Q9AQT6 7.42e-34 115 54 0 100 3 ureA Urease subunit gamma Rhodobacter capsulatus
O54418 7.75e-34 115 54 0 100 3 ureA Urease subunit gamma Actinobacillus pleuropneumoniae
A5UH46 7.92e-34 115 55 0 100 3 ureA Urease subunit gamma Haemophilus influenzae (strain PittGG)
P44393 9.97e-34 115 54 0 100 3 ureA Urease subunit gamma Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2IZ52 1.05e-33 115 53 0 100 3 ureA Urease subunit gamma Rhodopseudomonas palustris (strain HaA2)
A5GWV5 1.27e-33 114 52 0 100 3 ureA Urease subunit gamma Synechococcus sp. (strain RCC307)
B3QGK4 1.31e-33 114 54 0 100 3 ureA Urease subunit gamma Rhodopseudomonas palustris (strain TIE-1)
Q6N3N0 1.31e-33 114 54 0 100 3 ureA Urease subunit gamma Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P67720 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain MW2)
A8Z385 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain USA300 / TCH1516)
Q6G734 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain MSSA476)
Q6GEE6 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain MRSA252)
P67719 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain N315)
P67718 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJC8 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain Newman)
Q5HDS0 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain COL)
Q2YYQ8 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV69 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain JH9)
Q2FVW5 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEK5 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain USA300)
A6U412 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain JH1)
A7X5L9 1.92e-33 114 52 0 99 3 ureA Urease subunit gamma Staphylococcus aureus (strain Mu3 / ATCC 700698)
A1B1C2 2.32e-33 114 55 0 100 3 ureA Urease subunit gamma Paracoccus denitrificans (strain Pd 1222)
Q8CND1 2.59e-33 114 53 0 99 3 ureA Urease subunit gamma Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLW3 2.59e-33 114 53 0 99 3 ureA Urease subunit gamma Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B8GQ24 3.48e-33 113 58 0 100 3 ureA Urease subunit gamma Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q210F5 3.63e-33 113 55 0 100 3 ureA Urease subunit gamma Rhodopseudomonas palustris (strain BisB18)
Q3IRZ4 4.28e-33 113 53 0 100 3 ureA Urease subunit gamma Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q492E7 6.56e-33 112 58 0 99 3 ureA Urease subunit gamma Blochmanniella pennsylvanica (strain BPEN)
A4TAD3 1.34e-32 112 56 0 99 3 ureA Urease subunit gamma Mycolicibacterium gilvum (strain PYR-GCK)
P0C7K9 1.83e-32 112 57 0 99 3 ureA Urease subunit gamma Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJ75 1.83e-32 112 57 0 99 3 ureA Urease subunit gamma Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q21P96 2.07e-32 111 58 0 99 3 ureA Urease subunit gamma Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q7VRS4 2.19e-32 111 54 0 99 3 ureA Urease subunit gamma Blochmanniella floridana
Q18EB8 2.92e-32 111 51 0 100 3 ureA Urease subunit gamma Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
B9KK51 3.07e-32 111 54 0 100 3 ureA Urease subunit gamma Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q9RFF5 3.07e-32 111 54 0 100 3 ureA Urease subunit gamma Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PL42 3.07e-32 111 54 0 100 3 ureA Urease subunit gamma Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4WR72 6.76e-32 110 53 0 100 3 ureA Urease subunit gamma Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A1U500 7.14e-32 110 55 0 99 3 ureA Urease subunit gamma Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q28RK0 7.79e-32 110 54 0 100 3 ureA Urease subunit gamma Jannaschia sp. (strain CCS1)
A4F7F5 8.6e-32 110 53 0 100 3 ureA Urease subunit gamma Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
P0CB02 1.24e-31 109 55 0 99 3 ureA Urease subunit gamma Ureaplasma urealyticum
A8LRS4 1.39e-31 109 53 0 100 3 ureA Urease subunit gamma Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B5ZBT1 1.63e-31 109 55 0 99 3 ureA Urease subunit gamma Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q972V9 2.5e-31 112 60 0 100 3 ureAB Urease subunit gamma/beta Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q88J06 4.96e-31 108 57 0 99 3 ureA Urease subunit gamma Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KUZ9 4.96e-31 108 57 0 99 3 ureA Urease subunit gamma Pseudomonas putida (strain GB-1)
A5W4B8 4.96e-31 108 57 0 99 3 ureA Urease subunit gamma Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q75ZQ4 5.7e-31 108 50 0 100 3 ureA Urease subunit gamma Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q883F3 1.1e-30 111 50 0 100 3 ureAB Urease subunit gamma/beta Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZUD1 1.12e-30 111 50 0 100 3 ureAB Urease subunit gamma/beta Pseudomonas syringae pv. syringae (strain B728a)
Q1IBP2 2.86e-30 106 56 0 99 3 ureA Urease subunit gamma Pseudomonas entomophila (strain L48)
B1J813 3.15e-30 106 56 0 99 3 ureA Urease subunit gamma Pseudomonas putida (strain W619)
B1MB83 2.93e-28 101 59 0 99 3 ureA Urease subunit gamma Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q17VS7 6.31e-28 104 49 1 100 3 ureA Urease subunit alpha Helicobacter acinonychis (strain Sheeba)
P14916 1.21e-27 103 49 1 100 1 ureA Urease subunit alpha Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CV81 1.21e-27 103 49 1 100 3 ureA Urease subunit alpha Helicobacter pylori (strain HPAG1)
B6JPH6 1.21e-27 103 49 1 100 3 ureA Urease subunit alpha Helicobacter pylori (strain P12)
B2UW71 1.44e-27 103 49 1 100 3 ureA Urease subunit alpha Helicobacter pylori (strain Shi470)
Q9ZMZ4 1.54e-27 103 49 1 100 3 ureA Urease subunit alpha Helicobacter pylori (strain J99 / ATCC 700824)
Q93PJ5 4.77e-27 101 45 1 101 3 ureA Urease subunit alpha Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q8GH98 6.98e-27 101 49 1 100 3 ureA Urease subunit alpha Helicobacter bizzozeronii
P42822 7.36e-27 101 48 1 100 3 ureA Urease subunit alpha Helicobacter heilmannii
Q08715 3.1e-26 100 49 1 100 3 ureA Urease subunit alpha Helicobacter felis
A0QYE2 6.94e-26 95 57 0 99 3 ureA Urease subunit gamma Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1B870 2.6e-25 94 58 0 99 3 ureA Urease subunit gamma Mycobacterium sp. (strain MCS)
A1UGT7 2.6e-25 94 58 0 99 3 ureA Urease subunit gamma Mycobacterium sp. (strain KMS)
A3Q0D7 2.6e-25 94 58 0 99 3 ureA Urease subunit gamma Mycobacterium sp. (strain JLS)
P9WFE7 1.22e-24 92 55 0 99 1 ureA Urease subunit gamma Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFE6 1.22e-24 92 55 0 99 3 ureA Urease subunit gamma Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U3L5 1.22e-24 92 55 0 99 3 ureA Urease subunit gamma Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1APC5 1.22e-24 92 55 0 99 3 ureA Urease subunit gamma Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJR0 1.22e-24 92 55 0 99 3 ureA Urease subunit gamma Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A677 1.22e-24 92 55 0 99 3 ureA Urease subunit gamma Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P07374 2.09e-23 95 51 1 101 1 None Urease Canavalia ensiformis
P50044 3.62e-22 89 50 1 89 3 ureA Urease subunit alpha (Fragment) Helicobacter mustelae
E6Y5X0 4.52e-21 89 48 1 100 1 JBURE-II Urease 2 Canavalia ensiformis
E0ZS48 8.18e-21 88 46 1 101 1 None Urease Oryza sativa subsp. indica
B9GCH9 8.59e-21 88 46 1 101 3 Os12g0234800 Urease Oryza sativa subsp. japonica
Q9SR52 8.76e-21 88 47 1 101 1 URE Urease Arabidopsis thaliana
Q5FB24 1.94e-20 84 37 0 99 3 ureA Urease subunit alpha Campylobacter lari
P08298 5.45e-20 86 46 1 98 2 EU4 Urease Glycine max
Q6A3P9 9.9e-18 79 44 1 101 2 ure1 Urease Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
O13465 2.14e-16 76 43 1 101 1 URE1 Urease Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
P0CS22 2.36e-16 75 43 1 101 3 CNH01900 Urease Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CS23 2.36e-16 75 43 1 101 3 CNBL1900 Urease Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
O00084 2.61e-15 73 39 1 98 1 ure1 Urease Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O86507 4.56e-15 70 45 0 99 3 ureAB Urease subunit gamma/beta Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82JN8 8.91e-14 67 46 0 99 3 ureAB Urease subunit gamma/beta Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15270
Feature type CDS
Gene -
Product urease subunit gamma
Location 40461 - 40763 (strand: 1)
Length 303 (nucleotides) / 100 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000005
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1222
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00547 Urease, gamma subunit

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0831 Amino acid transport and metabolism (E) E Urease gamma subunit

Protein Sequence

MQLTPREVEKLMIYTLADVAQRRRDRGVKLNYPEAVAIITVTALEGARDGKTVEDVMKEAATVLTRADVMEGVDDLIPNVQVEAIFTDGSRLVTVHNPIK

Flanking regions ( +/- flanking 50bp)

TTTTAAATGCTGGTTTCAAGATCCTGTTTTCAATCCATTGTGGAGGCACTATGCAATTAACCCCGAGAGAAGTTGAAAAACTAATGATTTATACCCTGGCCGATGTCGCACAGCGACGCCGGGACCGGGGCGTAAAACTTAATTACCCGGAAGCTGTCGCGATTATTACGGTAACAGCTCTGGAAGGCGCCCGGGATGGCAAAACAGTGGAAGATGTGATGAAGGAAGCTGCCACGGTTCTGACCAGAGCCGATGTAATGGAAGGCGTTGATGATTTGATCCCGAATGTTCAGGTTGAGGCCATTTTTACAGACGGCAGCCGCCTGGTCACTGTTCATAACCCAATCAAGTAAACGCATAAGAAAGGTGAGGTTTCTGATTATGAGCAATACAAAACAACCGA