Homologs in group_1163

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06675 FBDBKF_06675 93.2 Morganella morganii S1 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
EHELCC_09720 EHELCC_09720 93.2 Morganella morganii S2 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
NLDBIP_10100 NLDBIP_10100 93.2 Morganella morganii S4 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
LHKJJB_07655 LHKJJB_07655 93.2 Morganella morganii S3 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
HKOGLL_07205 HKOGLL_07205 93.2 Morganella morganii S5 gsiA ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain
PMI_RS12425 PMI_RS12425 61.7 Proteus mirabilis HI4320 - ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_1163

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1163

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P50980 2.75e-25 105 30 6 241 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
P33916 4.84e-25 107 33 8 257 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 7.72e-13 71 29 7 213 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
Q07733 6.06e-25 104 30 6 241 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
P42064 1.32e-24 103 29 5 256 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
Q32IB5 2.32e-24 105 29 10 279 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 1.49e-15 79 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q0TJM0 6.96e-24 103 28 10 281 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 5.54e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A0A0H3JXA3 7.11e-24 100 30 6 225 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8FJL0 9.81e-24 103 28 10 281 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 5.54e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1RE96 1.19e-23 103 28 10 281 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 5.44e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q8X6W1 1.31e-23 103 29 10 279 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 1.22e-15 79 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
A1A967 1.34e-23 103 28 10 281 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 9.8e-14 73 27 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q323W5 1.72e-23 102 29 10 279 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 6.2e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q3Z3V4 1.93e-23 102 29 10 279 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 7.69e-15 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
P63396 2.44e-23 102 33 7 248 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 1.37e-05 49 25 5 232 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 2.44e-23 102 33 7 248 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 1.37e-05 49 25 5 232 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 2.44e-23 102 33 7 248 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 1.37e-05 49 25 5 232 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2FVF0 2.56e-23 99 30 6 225 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
P75796 2.83e-23 102 29 10 279 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 7.34e-15 77 28 4 232 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
Q0T6D3 2.33e-22 99 28 10 279 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 1.19e-14 77 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q83LT3 2.44e-22 99 28 10 279 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 1.31e-14 76 28 4 232 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
P77268 6.28e-22 96 31 6 240 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
Q57RB2 1.22e-21 97 28 8 259 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 6.06e-18 86 29 5 244 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q8ZQM4 1.23e-21 97 28 8 259 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 5.95e-18 86 29 5 244 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGP3 1.26e-21 97 28 8 259 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 1.63e-17 85 29 5 244 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9CKL2 1.3e-21 97 32 7 239 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 1.39e-10 64 24 6 231 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A0A0H2ZGN6 3.68e-21 94 31 9 248 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8Z864 4.23e-21 95 28 8 259 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 5.89e-18 86 29 5 244 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q1R5D9 4.72e-21 92 30 6 240 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain UTI89 / UPEC)
Q0TBX9 4.72e-21 92 30 6 240 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FCN0 1.04e-20 91 32 6 218 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32AQ2 2.23e-20 90 30 6 240 3 nikD Nickel import ATP-binding protein NikD Shigella dysenteriae serotype 1 (strain Sd197)
Q8YDH0 2.74e-20 91 29 8 253 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q83J78 5.39e-20 89 30 7 243 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
P24136 5.46e-20 91 29 7 240 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
Q0SZJ4 5.5e-20 89 30 7 243 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q2YK63 8.42e-20 90 26 7 271 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 8.42e-20 90 26 7 271 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
Q3YW49 9.18e-20 89 30 7 243 3 nikD Nickel import ATP-binding protein NikD Shigella sonnei (strain Ss046)
Q31VE7 9.76e-20 89 30 7 243 3 nikD Nickel import ATP-binding protein NikD Shigella boydii serotype 4 (strain Sb227)
P33593 1.05e-19 88 30 6 240 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain K12)
Q8X5U1 1.16e-19 88 30 6 240 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O157:H7
P0A2U9 2.09e-19 89 28 7 240 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 2.09e-19 89 28 7 240 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q2YJJ8 2.59e-19 89 30 5 235 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 2.59e-19 89 30 5 235 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
Q8YBN6 5.39e-19 88 26 7 271 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP1 5.39e-19 88 26 7 271 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
Q8FUW8 6.29e-19 87 28 8 253 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 6.29e-19 87 28 8 253 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 6.29e-19 87 28 8 253 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
A5VU87 6.58e-19 87 26 7 271 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P26905 6.9e-19 87 28 6 249 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
P27675 7.89e-19 86 29 5 222 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
O34677 1.46e-18 85 30 5 216 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q8YDH1 1.59e-18 87 30 5 238 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q6G1V5 1.72e-18 88 35 10 220 3 macB Macrolide export ATP-binding/permease protein MacB Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
P45052 2.89e-18 85 26 5 235 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q53193 3.56e-18 85 27 7 241 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9I190 4.03e-18 87 36 8 203 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02MI4 4.03e-18 87 36 8 203 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain UCBPP-PA14)
P45051 6.01e-18 85 26 5 233 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAG2 8.92e-18 84 28 6 241 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 8.92e-18 84 28 6 241 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 8.92e-18 84 28 6 241 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
Q2FVF1 9.98e-18 83 29 8 224 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
A2RI77 1.07e-17 84 25 5 237 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
P45095 2.6e-17 83 30 6 235 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q83LR7 2.84e-17 84 35 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q9CM47 3.91e-17 84 32 10 233 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q1CGD7 3.95e-17 84 35 8 207 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q66CL2 3.95e-17 84 35 8 207 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7CHI2 3.95e-17 84 35 8 207 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis
Q1CA99 3.95e-17 84 35 8 207 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Antiqua)
P0CZ33 4.24e-17 82 26 6 245 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 4.24e-17 82 26 6 245 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 4.24e-17 82 26 6 245 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 4.24e-17 82 26 6 245 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
Q4W575 5.57e-17 82 33 9 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 5.57e-17 82 33 9 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A0A0H3JT74 5.89e-17 81 29 8 224 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
P54537 5.98e-17 80 29 8 240 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q5FA19 6.21e-17 82 32 9 228 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q12R52 6.5e-17 81 32 9 250 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q81CT8 6.58e-17 83 28 6 224 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 1.35e-06 52 28 6 193 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2IXX0 6.71e-17 83 35 9 215 3 macB Macrolide export ATP-binding/permease protein MacB Rhodopseudomonas palustris (strain HaA2)
P04285 7.25e-17 82 27 6 245 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2YXY9 1.03e-16 80 26 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q32DZ9 1.2e-16 82 35 8 204 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
P76027 1.22e-16 81 27 6 236 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
Q50966 1.51e-16 81 31 8 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
P44513 1.72e-16 81 33 8 220 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8RDH4 1.97e-16 80 29 7 232 1 dppD Dipeptide transport ATP-binding protein DppD Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8XED0 2.34e-16 82 35 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q8P2L5 2.36e-16 80 26 6 245 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q1RE44 2.42e-16 82 35 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
A1A9B7 2.42e-16 82 35 7 203 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
Q6FYL0 2.44e-16 82 33 10 221 3 macB Macrolide export ATP-binding/permease protein MacB Bartonella quintana (strain Toulouse)
Q0TJH0 2.52e-16 81 35 7 203 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P75831 2.59e-16 81 35 7 203 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
Q3Z3Q4 2.61e-16 81 35 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
Q6GH27 3.25e-16 79 26 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MRSA252)
Q87JM4 3.61e-16 81 33 8 215 3 macB Macrolide export ATP-binding/permease protein MacB Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q217L2 3.86e-16 81 35 10 214 3 macB Macrolide export ATP-binding/permease protein MacB Rhodopseudomonas palustris (strain BisB18)
Q7A5Q8 3.97e-16 79 27 6 209 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain N315)
Q99UA2 3.97e-16 79 27 6 209 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain Mu50 / ATCC 700699)
A1RG29 4.18e-16 81 34 7 196 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella sp. (strain W3-18-1)
Q1I7I9 4.24e-16 81 31 9 222 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
P72479 4.49e-16 79 26 5 236 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q57R58 5.19e-16 80 36 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q5PGK9 5.81e-16 80 36 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2RPB4 6.04e-16 80 36 8 206 3 macB Macrolide export ATP-binding/permease protein MacB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8Z824 6.09e-16 80 36 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q4QP85 6.11e-16 79 32 7 219 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q8ZQE4 6.5e-16 80 36 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8YBN5 7.75e-16 79 27 5 233 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 7.75e-16 79 27 5 233 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 7.75e-16 79 27 5 233 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 7.75e-16 79 27 5 233 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 7.75e-16 79 27 5 233 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q82VK1 9.18e-16 80 32 8 213 3 macB Macrolide export ATP-binding/permease protein MacB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5L5Z1 9.21e-16 79 27 9 261 3 metN Methionine import ATP-binding protein MetN Chlamydia abortus (strain DSM 27085 / S26/3)
Q323M3 9.38e-16 80 34 7 203 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q6G9I0 9.89e-16 77 26 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MSSA476)
Q5HG40 9.89e-16 77 26 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain COL)
Q2FYQ7 9.89e-16 77 26 7 225 1 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH57 9.89e-16 77 26 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain USA300)
Q8EIL8 1.05e-15 80 34 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q4K9A4 1.18e-15 79 33 8 212 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7VMF9 1.26e-15 79 34 9 210 3 macB Macrolide export ATP-binding/permease protein MacB Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8NWT5 1.43e-15 77 26 7 225 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MW2)
Q6D3A9 1.44e-15 79 26 6 246 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 2.8e-14 75 26 6 240 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2RS22 1.61e-15 77 34 7 213 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q88F88 1.67e-15 79 31 8 214 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q03PY5 1.81e-15 77 30 9 243 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03Z27 1.94e-15 78 28 9 241 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1JII9 2.3e-15 78 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
P0A2V5 2.35e-15 77 25 4 229 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 2.35e-15 77 25 4 229 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q3ATR5 2.53e-15 79 32 10 234 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium chlorochromatii (strain CaD3)
A2RI78 2.62e-15 77 26 6 242 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
Q31VE6 3.06e-15 76 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
P24137 3.7e-15 77 27 6 235 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
Q737I0 4.2e-15 78 26 7 238 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 3.49e-08 57 29 7 191 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q2SMN9 4.26e-15 78 32 8 225 3 macB Macrolide export ATP-binding/permease protein MacB Hahella chejuensis (strain KCTC 2396)
Q897I2 4.31e-15 77 25 7 225 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q07LU3 4.41e-15 76 33 5 207 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
A0L0V9 4.6e-15 78 33 8 205 3 macB Macrolide export ATP-binding/permease protein MacB Shewanella sp. (strain ANA-3)
P18766 4.73e-15 76 26 5 235 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q3SQZ1 5.21e-15 77 33 7 204 3 macB Macrolide export ATP-binding/permease protein MacB Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1BE50 5.45e-15 77 33 9 206 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q32AQ1 6.59e-15 75 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
Q1WSB9 7.37e-15 75 29 6 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q1BJA5 7.81e-15 75 32 9 233 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 7.81e-15 75 32 9 233 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q8X4L6 8.29e-15 75 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q7N6F9 8.5e-15 77 33 8 208 3 macB Macrolide export ATP-binding/permease protein MacB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q81PZ8 8.97e-15 77 26 7 240 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 5.62e-08 57 31 5 180 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q92NU9 9.6e-15 77 33 7 204 3 macB Macrolide export ATP-binding/permease protein MacB Rhizobium meliloti (strain 1021)
P33594 1.04e-14 75 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q3YW48 1.09e-14 75 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q0ASQ1 1.13e-14 75 34 7 212 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q035B2 1.13e-14 75 30 8 259 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q0B697 1.14e-14 75 33 10 233 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8CRI7 1.17e-14 75 26 6 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q6HI76 1.37e-14 76 25 7 240 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 5.18e-08 57 31 5 180 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q9Z8Q8 1.39e-14 75 28 8 226 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
P14788 1.4e-14 75 29 6 228 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0KGB3 1.45e-14 76 34 8 214 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P36636 1.57e-14 75 27 7 248 2 sapD Peptide transport system ATP-binding protein SapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q81IZ6 1.64e-14 75 28 10 256 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P0CZ31 1.85e-14 75 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 1.85e-14 75 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q58967 1.89e-14 74 30 6 213 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0A2V2 2.01e-14 74 28 7 236 2 occP Octopine permease ATP-binding protein P Rhizobium radiobacter
P0A2V3 2.01e-14 74 28 7 236 3 occP Octopine permease ATP-binding protein P Agrobacterium tumefaciens (strain Ach5)
Q2SB47 2.07e-14 74 33 6 210 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q2KVK2 2.12e-14 75 31 8 219 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q8ELA5 2.16e-14 75 29 10 250 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A0KMJ3 2.45e-14 75 31 8 219 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
O34697 2.61e-14 73 31 9 217 1 bceA Bacitracin export ATP-binding protein BceA Bacillus subtilis (strain 168)
Q73F11 2.66e-14 75 28 10 256 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q2RS21 3.17e-14 73 33 10 223 3 nikD Nickel import ATP-binding protein NikD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8P2K6 3.2e-14 74 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q02592 3.42e-14 75 27 7 231 2 hmt1 Heavy metal tolerance protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A0H2ZH52 3.63e-14 74 26 5 232 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
Q972J5 3.66e-14 75 29 8 201 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q2EHL8 3.76e-14 75 31 8 213 1 macB Macrolide export ATP-binding/permease protein MacB Aggregatibacter actinomycetemcomitans
Q8RD07 3.91e-14 73 30 4 219 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q48QM2 3.93e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 3.93e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 3.93e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q5HM28 3.96e-14 73 25 6 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1R5D8 4.05e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 4.05e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 4.05e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P45094 4.08e-14 74 25 5 232 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4L8L7 4.11e-14 72 33 9 207 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus haemolyticus (strain JCSC1435)
Q89NX6 4.35e-14 75 33 7 213 3 macB Macrolide export ATP-binding/permease protein MacB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P0C0E9 4.42e-14 73 29 10 240 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 4.42e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 4.42e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 4.42e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 4.42e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 4.42e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 4.42e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 4.42e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q0SZJ3 4.6e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
P74548 4.78e-14 74 30 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9KRT4 4.8e-14 74 29 7 246 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9K619 4.83e-14 73 30 8 210 3 bceA Bacitracin export ATP-binding protein BceA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q88HL0 5.13e-14 73 31 7 220 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q48V78 5.18e-14 74 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 5.18e-14 74 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q63H29 5.23e-14 74 28 10 256 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q81VM2 5.38e-14 74 28 10 256 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q83J77 6.07e-14 73 31 4 216 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q1JNE0 6.1e-14 73 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 6.1e-14 73 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0AAH7 6.27e-14 73 28 7 248 3 sapD Peptide transport system ATP-binding protein SapD Shigella flexneri
P0AAH4 6.27e-14 73 28 7 248 1 sapD Putrescine export system ATP-binding protein SapD Escherichia coli (strain K12)
P0AAH5 6.27e-14 73 28 7 248 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAH6 6.27e-14 73 28 7 248 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O157:H7
Q4KC87 6.4e-14 73 35 8 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1J982 6.89e-14 73 29 10 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5XDS8 6.91e-14 73 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q82VL9 7.26e-14 72 32 7 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8FVM9 8.22e-14 72 30 8 233 2 nikD Nickel import ATP-binding protein NikD Brucella suis biovar 1 (strain 1330)
Q8FV85 8.97e-14 73 30 10 242 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 8.97e-14 73 30 10 242 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 8.97e-14 73 30 10 242 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 8.97e-14 73 30 10 242 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q48KB2 1.06e-13 73 33 7 205 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q74L62 1.06e-13 72 27 7 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q3KF57 1.08e-13 73 33 7 205 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain Pf0-1)
A1VYW8 1.16e-13 73 31 8 216 3 macB Macrolide export ATP-binding/permease protein MacB Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P42065 1.17e-13 73 23 5 267 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
Q8YCN8 1.29e-13 72 30 8 233 3 nikD Nickel import ATP-binding protein NikD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S8 1.29e-13 72 30 8 233 3 nikD Nickel import ATP-binding protein NikD Brucella abortus biovar 1 (strain 9-941)
Q2YL70 1.29e-13 72 30 8 233 3 nikD Nickel import ATP-binding protein NikD Brucella abortus (strain 2308)
P55339 1.33e-13 72 28 6 202 1 ecsA ABC-type transporter ATP-binding protein EcsA Bacillus subtilis (strain 168)
Q6GH28 1.35e-13 71 25 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MRSA252)
Q5YRD1 1.42e-13 72 30 7 223 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q8D954 1.47e-13 73 30 7 236 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain CMCP6)
Q0PAR0 1.66e-13 73 31 8 214 3 macB Macrolide export ATP-binding/permease protein MacB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q7MLB8 1.71e-13 72 30 7 236 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain YJ016)
Q39GT7 1.73e-13 72 29 5 215 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5HVG3 1.74e-13 73 31 8 216 3 macB Macrolide export ATP-binding/permease protein MacB Campylobacter jejuni (strain RM1221)
Q88XV2 1.79e-13 72 29 8 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8FRX8 1.81e-13 72 30 7 207 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8XXB6 1.86e-13 73 32 9 226 3 msbA ATP-dependent lipid A-core flippase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4ZT65 1.88e-13 73 34 8 204 3 syfD Probable syringafactin export ATP-binding/permease protein SyfD Pseudomonas syringae pv. syringae (strain B728a)
Q3KE48 1.9e-13 73 35 8 202 3 Pfl01_2215 Probable export ATP-binding/permease protein Pfl01_2215 Pseudomonas fluorescens (strain Pf0-1)
Q5P6D5 1.91e-13 73 33 8 212 3 macB Macrolide export ATP-binding/permease protein MacB Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q884D4 2.05e-13 73 32 7 205 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1J8E4 2.29e-13 72 28 7 232 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q83F44 2.36e-13 72 30 6 209 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q47JR8 2.36e-13 72 32 9 244 3 msbA ATP-dependent lipid A-core flippase Dechloromonas aromatica (strain RCB)
Q1QDA8 2.42e-13 73 29 6 208 3 macB Macrolide export ATP-binding/permease protein MacB Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q2KVS6 2.9e-13 72 32 8 215 3 macB Macrolide export ATP-binding/permease protein MacB Bordetella avium (strain 197N)
Q668L6 2.93e-13 72 33 8 206 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q67JX4 3.22e-13 71 31 5 202 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q7CJG3 3.25e-13 72 33 8 206 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q1C5W7 3.25e-13 72 33 8 206 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CJW8 3.25e-13 72 33 8 206 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q3IWB5 3.33e-13 70 31 10 244 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A1K323 3.46e-13 72 32 6 202 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
A0A0H2ZLL3 3.7e-13 70 28 6 228 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8REG7 3.84e-13 70 25 6 212 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7VZ31 3.95e-13 70 35 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W8T0 3.95e-13 70 35 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WK40 3.95e-13 70 35 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3AKM8 4.07e-13 70 30 10 242 3 phnC Phosphonates import ATP-binding protein PhnC Synechococcus sp. (strain CC9605)
Q8NQU4 4.45e-13 70 28 8 267 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q4FU75 4.91e-13 72 29 6 208 3 macB Macrolide export ATP-binding/permease protein MacB Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
C0SP98 4.94e-13 71 26 5 245 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
Q8KFE9 5.11e-13 72 30 8 212 3 macB Macrolide export ATP-binding/permease protein MacB Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9A9P4 5.13e-13 70 36 9 202 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P08007 5.2e-13 71 25 8 244 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q138A9 5.24e-13 70 29 6 225 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB5)
P45022 5.62e-13 70 29 8 224 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7NUJ3 5.74e-13 72 34 7 202 3 macB Macrolide export ATP-binding/permease protein MacB Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2NIT5 5.75e-13 70 29 8 218 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q21BU8 5.83e-13 71 29 8 241 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
P72335 5.93e-13 70 30 9 222 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
O85818 6.45e-13 71 30 6 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
G5EFD4 7.16e-13 71 29 7 235 2 hmt-1 Heavy metal tolerance factor 1 Caenorhabditis elegans
P45171 7.51e-13 70 30 6 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6LQ00 7.82e-13 71 27 8 243 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q8RQL7 8.25e-13 69 27 6 219 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q6D8T5 8.37e-13 71 33 8 206 3 macB Macrolide export ATP-binding/permease protein MacB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P47705 8.38e-13 70 28 7 207 3 MG467 Putative ABC transporter ATP-binding protein MG467 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q65P77 8.46e-13 70 31 8 208 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q7NN36 8.95e-13 70 30 8 234 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8DWR3 9.06e-13 70 29 7 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 9.06e-13 70 29 7 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 9.06e-13 70 29 7 215 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5HG41 9.08e-13 69 25 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain COL)
Q2FYQ8 9.08e-13 69 25 4 235 1 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH58 9.08e-13 69 25 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain USA300)
Q2FRT7 9.4e-13 70 29 9 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8NWT6 9.73e-13 69 25 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MW2)
Q6G9I1 9.73e-13 69 25 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MSSA476)
Q7A5Q9 1.1e-12 68 25 4 231 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain N315)
Q99UA3 1.1e-12 68 25 4 231 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q4ZV10 1.1e-12 70 30 9 252 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas syringae pv. syringae (strain B728a)
Q8U4L3 1.11e-12 69 29 8 217 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6YRJ4 1.23e-12 70 28 10 215 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q2G7G7 1.25e-12 68 32 10 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q52666 1.42e-12 69 27 7 231 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P77737 1.42e-12 70 25 6 244 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q8YCN7 1.52e-12 69 31 7 218 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 1.52e-12 69 31 7 218 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 1.52e-12 69 31 7 218 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q8FVT0 1.58e-12 70 31 11 240 3 BRA0745 Putative ATP-binding protein BRA0745/BS1330_II0738 Brucella suis biovar 1 (strain 1330)
Q2YKZ7 1.58e-12 70 31 11 240 3 BAB2_0493 Putative ATP-binding protein BAB2_0493 Brucella abortus (strain 2308)
Q578M5 1.58e-12 70 31 11 240 3 BruAb2_0487 Putative ATP-binding protein BruAb2_0487 Brucella abortus biovar 1 (strain 9-941)
Q217B2 1.62e-12 69 32 8 219 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisB18)
Q65TH4 1.68e-12 70 29 6 212 3 macB Macrolide export ATP-binding/permease protein MacB Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q6LQC0 1.71e-12 69 29 11 232 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium profundum (strain SS9)
Q8ELQ6 1.74e-12 69 29 7 216 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4KES7 1.75e-12 70 34 8 202 3 PFL_2149 Probable export ATP-binding/permease protein PFL_2149 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q49ZT6 1.77e-12 68 31 8 216 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q31J97 1.78e-12 68 30 8 214 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q823C4 2.09e-12 69 27 7 237 3 metN Methionine import ATP-binding protein MetN Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
O31711 2.14e-12 68 28 8 220 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q8FVN0 2.21e-12 68 31 7 218 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q9DC29 2.22e-12 70 29 7 226 1 Abcb6 ATP-binding cassette sub-family B member 6 Mus musculus
F8DT93 2.32e-12 68 32 9 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
Q045Z8 2.46e-12 68 29 8 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q1I966 2.49e-12 70 35 9 202 3 macB Probable export ATP-binding/permease protein MacB Pseudomonas entomophila (strain L48)
Q53194 2.61e-12 69 28 6 232 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q63VX7 2.66e-12 69 31 8 237 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain K96243)
Q3JUI6 2.66e-12 69 31 8 237 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain 1710b)
Q62IG3 2.66e-12 69 31 8 237 3 msbA ATP-dependent lipid A-core flippase Burkholderia mallei (strain ATCC 23344)
P0DJA1 2.69e-12 67 32 9 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q2NSZ1 2.73e-12 69 34 7 218 3 macB Macrolide export ATP-binding/permease protein MacB Sodalis glossinidius (strain morsitans)
P17328 2.74e-12 69 27 6 230 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P14175 2.74e-12 69 26 6 230 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q0VQQ0 2.81e-12 67 32 7 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q92AF9 2.82e-12 68 27 5 219 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8YA75 2.87e-12 68 29 8 209 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q2YXZ0 2.89e-12 67 25 4 235 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain bovine RF122 / ET3-1)
P38045 2.9e-12 69 32 6 206 1 nrtC Nitrate import ATP-binding protein NrtC Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5E5I1 2.91e-12 68 29 9 227 3 hmuV Hemin import ATP-binding protein HmuV Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6F813 2.91e-12 69 32 7 206 3 macB Macrolide export ATP-binding/permease protein MacB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P37313 2.91e-12 68 25 7 257 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
Q5L3R0 3.03e-12 68 30 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
O34392 3.07e-12 67 29 8 215 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q3JSQ0 3.12e-12 68 29 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 3.12e-12 68 29 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q9FUT3 3.13e-12 69 25 7 240 1 ABCB23 ABC transporter B family member 23, mitochondrial Arabidopsis thaliana
Q63TX3 3.21e-12 68 29 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q12NL5 3.29e-12 67 31 9 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8RI39 3.33e-12 68 28 7 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A0A125QXJ1 3.34e-12 69 29 7 223 2 ABCB6 ATP-binding cassette sub-family B member 6 Mesocricetus auratus
Q10418 3.44e-12 69 27 8 234 3 mesD Mesentericin-Y105 transport/processing ATP-binding protein MesD Leuconostoc mesenteroides
Q2L219 3.52e-12 67 32 8 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella avium (strain 197N)
O27739 3.58e-12 68 28 5 210 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8E3S6 3.58e-12 69 23 4 204 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8DIA0 3.81e-12 68 29 7 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q4QK57 3.86e-12 68 30 6 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q46Y89 3.88e-12 69 31 8 228 3 msbA ATP-dependent lipid A-core flippase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P45769 3.97e-12 67 29 7 211 3 yhdZ Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ Escherichia coli (strain K12)
Q0A4U4 3.99e-12 69 31 9 246 3 msbA ATP-dependent lipid A-core flippase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
P48243 4.16e-12 67 26 4 223 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q2SZW0 4.16e-12 69 29 7 232 3 msbA ATP-dependent lipid A-core flippase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q03EE4 4.25e-12 68 25 7 241 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q5QXD0 4.29e-12 67 27 8 244 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q5ZUG5 4.51e-12 68 29 9 213 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X484 4.56e-12 68 29 9 213 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q1R597 4.72e-12 67 30 9 228 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
P70970 4.74e-12 67 29 9 250 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q8DY60 4.92e-12 68 23 4 204 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 0.000477 44 24 4 181 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q2W450 4.99e-12 67 34 10 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
O31339 5.2e-12 68 29 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q7VV72 5.47e-12 68 32 9 211 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 5.47e-12 68 32 9 211 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 5.47e-12 68 32 9 211 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q724C0 5.48e-12 68 29 8 209 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
A1B9H9 5.81e-12 67 32 6 210 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
Q9NP58 6e-12 68 28 8 234 1 ABCB6 ATP-binding cassette sub-family B member 6 Homo sapiens
Q5WVL8 6.12e-12 68 29 9 213 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
P55453 6.17e-12 68 27 5 229 3 NGR_a03670 Uncharacterized ABC transporter ATP-binding protein y4fO Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q74I62 6.34e-12 68 25 9 264 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 5.07e-06 50 24 5 221 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A1U0A9 6.4e-12 68 33 6 200 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q88HL1 6.46e-12 67 31 7 241 3 nikD Nickel import ATP-binding protein NikD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q32AY3 6.71e-12 67 30 9 230 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
Q2RU16 6.71e-12 66 30 9 228 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9X051 6.72e-12 68 27 5 207 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9X051 6.2e-06 50 21 4 233 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q04DA7 7.08e-12 68 26 8 242 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q0I3Y9 7.12e-12 68 29 6 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q6N798 7.38e-12 68 30 7 243 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q6N9W0 7.42e-12 68 32 6 207 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q08D64 7.72e-12 68 27 8 234 2 abcb6 ATP-binding cassette sub-family B member 6 Xenopus tropicalis
Q3J7S3 7.98e-12 66 31 9 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5JEB0 8.12e-12 67 27 10 247 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q1QE80 8.41e-12 68 30 4 204 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q399M3 8.65e-12 68 33 6 202 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9I6L0 9.14e-12 67 29 7 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7NWX3 9.24e-12 67 32 9 237 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q881Q1 9.41e-12 68 32 10 227 2 syfD Probable syringafactin export ATP-binding/permease protein SyfD Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9M0G9 9.64e-12 68 24 7 245 1 ABCB24 ABC transporter B family member 24, mitochondrial Arabidopsis thaliana
Q8TIX0 1.05e-11 67 27 6 218 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8FCJ1 1.05e-11 66 30 9 230 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 1.05e-11 66 30 9 230 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q88AS5 1.08e-11 67 31 7 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q81GU1 1.1e-11 67 29 6 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q3MB44 1.14e-11 67 27 7 225 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q2RQQ0 1.16e-11 66 34 6 201 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6D201 1.17e-11 67 28 8 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1BCE9 1.29e-11 67 33 5 191 3 macB3 Macrolide export ATP-binding/permease protein MacB 3 Paracoccus denitrificans (strain Pd 1222)
P47425 1.38e-11 66 25 6 208 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8DRR9 1.4e-11 66 28 7 219 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P10346 1.48e-11 65 27 5 233 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q32K28 1.51e-11 65 30 5 233 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella dysenteriae serotype 1 (strain Sd197)
Q6YR39 1.52e-11 66 29 7 210 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q70GD4 1.53e-11 66 29 6 227 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q97X60 1.55e-11 67 28 7 244 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97X60 1.73e-06 52 22 5 252 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q92EZ6 1.59e-11 67 29 8 209 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q52815 1.62e-11 66 28 9 215 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6AE21 1.65e-11 67 31 7 223 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q7NAQ6 1.65e-11 66 25 7 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q88CL2 1.66e-11 66 31 9 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1BWI2 1.69e-11 66 29 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q92LU2 1.74e-11 67 29 7 206 3 modC Molybdenum import ATP-binding protein ModC Rhizobium meliloti (strain 1021)
Q3MGT2 1.75e-11 65 33 6 208 3 phnC Phosphonates import ATP-binding protein PhnC Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5HLN4 1.76e-11 65 30 9 215 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q38UT9 1.82e-11 66 30 7 220 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8CRB0 1.83e-11 65 30 9 215 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q042G7 1.85e-11 67 28 9 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q88ZZ2 1.9e-11 67 26 8 225 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 7.88e-09 59 26 8 243 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q2SVP3 1.92e-11 66 29 7 220 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q326G9 1.93e-11 65 30 5 233 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella boydii serotype 4 (strain Sb227)
Q9A6Z7 1.94e-11 65 31 8 209 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1LQF6 1.99e-11 66 30 7 215 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q65TB7 2.02e-11 65 29 8 214 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9G4F5 2.03e-11 66 29 8 225 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q254K9 2.03e-11 66 26 7 237 3 metN Methionine import ATP-binding protein MetN Chlamydia felis (strain Fe/C-56)
Q8YUI9 2.07e-11 65 33 6 208 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8PYH5 2.07e-11 66 28 6 219 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q28P50 2.08e-11 67 27 4 212 3 rbsA Ribose import ATP-binding protein RbsA Jannaschia sp. (strain CCS1)
Q83MG3 2.19e-11 65 30 4 213 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
Q65S66 2.19e-11 66 25 8 254 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8XK20 2.28e-11 67 24 5 230 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q5FKL2 2.3e-11 66 26 8 220 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
O70014 2.34e-11 65 30 9 230 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q5AV01 2.42e-11 67 30 7 220 2 atnG ABC transporter atnG Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q0SFW6 2.62e-11 66 28 7 240 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
Q21NS8 2.63e-11 67 29 9 227 3 msbA ATP-dependent lipid A-core flippase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1CI46 2.68e-11 65 30 9 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 2.68e-11 65 30 9 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 2.68e-11 65 30 9 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q6D2F6 2.77e-11 66 32 9 225 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q28QL7 2.83e-11 66 29 7 231 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Jannaschia sp. (strain CCS1)
Q1RK34 2.86e-11 65 31 8 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Rickettsia bellii (strain RML369-C)
Q8UH62 2.93e-11 66 27 5 228 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q97KD5 2.99e-11 65 27 7 240 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P34713 3.01e-11 67 30 11 244 2 pgp-3 Multidrug resistance protein pgp-3 Caenorhabditis elegans
P34713 3.94e-07 54 27 9 233 2 pgp-3 Multidrug resistance protein pgp-3 Caenorhabditis elegans
Q65UE1 3.1e-11 66 29 6 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q110U3 3.12e-11 66 26 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q82B58 3.16e-11 66 31 9 227 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q82B58 8.29e-10 62 29 9 235 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9LVM1 3.17e-11 66 25 7 233 1 ABCB25 ABC transporter B family member 25, mitochondrial Arabidopsis thaliana
Q98L75 3.33e-11 65 26 13 267 3 hmuV Hemin import ATP-binding protein HmuV Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q080S4 3.33e-11 65 30 8 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella frigidimarina (strain NCIMB 400)
Q92VJ2 3.37e-11 66 27 7 226 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q5MZ54 3.41e-11 66 32 8 206 3 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q55107 3.41e-11 66 32 8 206 1 cmpC Bicarbonate transport ATP-binding protein CmpC Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q50294 3.42e-11 65 27 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2YYM5 3.61e-11 65 24 9 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q882S0 3.61e-11 65 29 8 239 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q669P3 3.63e-11 64 30 9 229 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q2M3G0 3.66e-11 66 31 9 222 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q2M3G0 8.64e-09 59 27 6 222 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q7N6Z2 3.67e-11 65 27 7 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D645 3.93e-11 65 32 6 218 3 hmuV Hemin import ATP-binding protein HmuV Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5QU46 3.94e-11 64 32 8 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q5WUF8 4.13e-11 64 32 7 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
A3CRB9 4.21e-11 65 29 7 220 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q8Y651 4.39e-11 64 27 5 219 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q0C1N8 4.5e-11 66 31 10 236 3 macB Macrolide export ATP-binding/permease protein MacB Hyphomonas neptunium (strain ATCC 15444)
Q8EEV5 4.5e-11 64 30 8 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q93D97 4.61e-11 66 24 5 222 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 1.5e-06 52 25 11 247 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q62K82 4.71e-11 65 28 7 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q5XBY7 4.79e-11 64 29 7 226 3 pstB1 Phosphate import ATP-binding protein PstB 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8DRF9 4.79e-11 65 24 8 261 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8XA06 4.85e-11 64 30 5 233 3 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli O157:H7
Q3IZT1 5.12e-11 64 33 10 214 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P16678 5.12e-11 64 27 8 237 1 phnK Putative phosphonates utilization ATP-binding protein PhnK Escherichia coli (strain K12)
Q5H0G3 5.17e-11 64 30 6 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3E1 5.17e-11 64 30 6 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q50801 5.21e-11 65 27 6 211 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q63TY1 5.32e-11 65 28 7 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q9K6J9 5.51e-11 65 26 8 249 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q93SS1 5.51e-11 64 29 7 242 3 hmuV Hemin import ATP-binding protein HmuV Plesiomonas shigelloides
Q0SXQ1 5.82e-11 65 32 6 202 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri serotype 5b (strain 8401)
P40860 6.1e-11 65 29 6 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P54954 6.2e-11 64 30 7 218 1 yxeO Probable amino-acid import ATP-binding protein YxeO Bacillus subtilis (strain 168)
Q8K440 6.24e-11 66 27 6 233 1 Abca8b ABC-type organic anion transporter ABCA8B Mus musculus
Q8K440 3.84e-09 60 30 7 204 1 Abca8b ABC-type organic anion transporter ABCA8B Mus musculus
O34992 6.27e-11 65 27 6 220 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
Q5NHP2 6.55e-11 63 28 8 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q2A4V5 6.55e-11 63 28 8 221 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain LVS)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15265
Feature type CDS
Gene -
Product ATP-binding cassette domain-containing protein
Location 39207 - 40007 (strand: 1)
Length 801 (nucleotides) / 266 (amino acids)

Contig

Accession term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1163
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1123 Posttranslational modification, protein turnover, chaperones (O) O ABC-type glutathione transport system ATPase component, contains duplicated ATPase domain

Protein Sequence

MLKFDQLAIDVAQFNWLRKKRWQPLLKDISLTIHPGELVALIGSSGEGKSLLLQSALGLLPDNMRCRGAISLAGETLTEATKQRHRGNTLCYVPQGVSALNPLVRVGPQLERAATLSGMHVKMHDVARQLQRYNLRPELTDAFPNRLSGGMAKRVLTCGATLTGAQYILADEITSWLDDEHAGQLLAHLKVLCGDGRGVLWVTHDLAMAARFADRIAVLRHGVLQETLTSQALLSGEGSPWLQSLWDALPEHRFLNGAKQNRQWHQ

Flanking regions ( +/- flanking 50bp)

TTTGACCAGTTTGCAAAAGCGTTACAACAGCTCTGGCTGAGGATCGCATAATGCTGAAATTTGACCAGCTTGCTATTGATGTCGCACAGTTTAACTGGCTGAGAAAAAAACGCTGGCAGCCGCTGCTGAAAGATATCTCCCTGACTATTCATCCGGGAGAGCTGGTGGCACTGATTGGCAGCAGCGGTGAAGGTAAAAGCCTGTTACTGCAAAGTGCGCTGGGATTGCTGCCGGATAATATGCGCTGCCGTGGTGCCATTTCTCTGGCAGGGGAAACGCTGACAGAAGCGACAAAACAGCGCCACCGCGGAAATACCCTGTGTTATGTGCCGCAGGGGGTCAGTGCGCTGAACCCGCTGGTGCGGGTTGGTCCGCAGCTTGAACGCGCGGCAACACTAAGCGGAATGCACGTAAAAATGCATGATGTGGCGCGTCAGCTGCAACGTTATAACCTGCGTCCGGAGCTGACGGATGCATTTCCGAACCGGCTGTCCGGCGGAATGGCAAAGCGGGTGCTGACCTGTGGCGCAACACTGACCGGCGCACAGTATATTTTAGCGGATGAAATAACGTCCTGGTTGGATGATGAACACGCAGGGCAATTGCTCGCGCACCTGAAAGTATTGTGCGGGGACGGGCGTGGAGTGTTGTGGGTCACGCATGACCTGGCAATGGCGGCGCGTTTTGCCGACAGAATAGCGGTTCTGCGTCACGGGGTTTTACAGGAAACGCTGACCTCACAGGCATTGCTCAGCGGAGAAGGCAGTCCCTGGCTGCAATCCTTATGGGATGCATTACCGGAGCACCGTTTTCTCAATGGTGCAAAACAGAACCGGCAGTGGCACCAATAATAATGACCGGCGATCCGGATGCAATAATATGTTTTATTTTATCCGGATAT